Gene/Proteome Database (LMPD)

LMPD ID
LMP012240
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
fatty acid binding protein 1a, liver
Gene Symbol
Synonyms
fabp1; L-FABP
Chromosome
5

Proteins

fatty acid binding protein 1-A, liver
Refseq ID NP_001038177
Protein GI 113374121
UniProt ID Q1AMT3
mRNA ID NM_001044712
Length 127
RefSeq Status PROVISIONAL
MAFTGKYQLESHENFEAFMKAVGVPDDEVEKGKDIKSISEIHQDGKDFKVTVTAGTKVILYSFTVGEECELETFTGDRAKTVVQMDGNKLTAFVKGIESVTELDGDTISNTLSFNGIVYKRISRRIS

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 1a, liver
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0005504 ISS:ZFIN F fatty acid binding
GO:0005215 IEA:InterPro F transporter activity

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 1a, liver
Protein Entry
Q1AMT3_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Function Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport (By similarity).
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Subcellular Location Cytoplasm .
Tissue Specificity In adults, weakly expressed in the intestine.

Identical and Related Proteins

Unique RefSeq proteins for LMP012240 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
113374121 RefSeq NP_001038177 127 fatty acid binding protein 1-A, liver

Identical Sequences to LMP012240 proteins

Reference Database Accession Length Protein Name
GI:113374121 GenBank AAZ08575.1 127 fatty acid binding protein 1a [Danio rerio]
GI:113374121 GenBank AAI63809.1 127 Fabp1a protein [Danio rerio]
GI:113374121 GenBank AAI63810.1 127 Fabp1a protein [Danio rerio]
GI:113374121 SwissProt Q1AMT3.1 127 RecName: Full=Fatty acid binding protein 1-A, liver [Danio rerio]

Related Sequences to LMP012240 proteins

Reference Database Accession Length Protein Name
GI:113374121 GenBank KFO11003.1 126 Fatty acid-binding protein, liver [Balearica regulorum gibbericeps]
GI:113374121 RefSeq XP_007254047.1 127 PREDICTED: fatty acid-binding protein, liver-type-like isoform X1 [Astyanax mexicanus]
GI:113374121 RefSeq XP_007254048.1 127 PREDICTED: fatty acid-binding protein, liver-type-like isoform X2 [Astyanax mexicanus]
GI:113374121 RefSeq XP_007254049.1 127 PREDICTED: fatty acid-binding protein, liver-type-like isoform X3 [Astyanax mexicanus]
GI:113374121 RefSeq XP_009554280.1 127 PREDICTED: fatty acid-binding protein, liver [Cuculus canorus]
GI:113374121 RefSeq XP_010301034.1 126 PREDICTED: fatty acid-binding protein, liver [Balearica regulorum gibbericeps]