Gene/Proteome Database (LMPD)
Proteins
| palmitoyltransferase ZDHHC15 | |
|---|---|
| Refseq ID | NP_001071249 |
| Protein GI | 118150580 |
| UniProt ID | A0JMB1 |
| mRNA ID | NM_001077781 |
| Length | 332 |
| RefSeq Status | PROVISIONAL |
| MALSRALRCCQRIFSWIPVIIISSVVLWSYYAYVFELCFVTLSNNLGRVTYLLIFHVCFIMFCWTYWKAIFTPPSTPTKKFHLSYTDKERYEMEERPEVQKQILVDIAKKLPIFTRAQSGAIRFCDRCQVIKPDRCHHCSVCETCVLKMDHHCPWVNNCVGFSNYKFFLLFLSYSMIYCVFIASTVFQYFLKFWVGDLPNGPAKFHVLFLLFVALMFFVSLMFLFGYHCWLVAKNRSTLEAFSPPVFQNGPDRNGFNVGLNKNLRQVFGEHKKLWFIPVFTSQGDGHYFPLRTLRESENPLLANEEKWVEDGGSDEESADENGSSLLIRTES | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 15b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 15b
Protein Entry
A0JMB1_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012226 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 118150580 | RefSeq | NP_001071249 | 332 | palmitoyltransferase ZDHHC15 |
Identical Sequences to LMP012226 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:118150580 | GenBank | AAI25811.1 | 332 | Zgc:152683 [Danio rerio] |
Related Sequences to LMP012226 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:118150580 | GenBank | AAI14274.1 | 330 | Zgc:152683 protein, partial [Danio rerio] |
| GI:118150580 | GenBank | AHH42916.1 | 333 | Palmitoyltransferase ZDHHC15 [Ictalurus punctatus] |
| GI:118150580 | RefSeq | XP_006632707.1 | 332 | PREDICTED: palmitoyltransferase ZDHHC15-like [Lepisosteus oculatus] |
| GI:118150580 | RefSeq | XP_007228480.1 | 335 | PREDICTED: palmitoyltransferase ZDHHC15-like isoform X1 [Astyanax mexicanus] |
| GI:118150580 | RefSeq | XP_007228481.1 | 335 | PREDICTED: palmitoyltransferase ZDHHC15-like isoform X2 [Astyanax mexicanus] |
| GI:118150580 | RefSeq | XP_008282599.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 [Stegastes partitus] |