Gene/Proteome Database (LMPD)

LMPD ID
LMP012214
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
platelet derived growth factor alpha b
Gene Symbol
Synonyms
wu:fc32c12; zgc:153249
Chromosome
3

Proteins

platelet derived growth factor alpha b precursor
Refseq ID NP_001070225
Protein GI 115529395
UniProt ID Q08CD2
mRNA ID NM_001076757
Length 230
RefSeq Status PROVISIONAL
MRTLFCCFLLLTSHLLLAAAEKEFPIPQEFIDRLSHSEINSISDLQRLLEVNSPGPGNEVTEEVKQKHHQKSQHSYKSFASDLKSRQLSHRRKRSIVEEAVPAMCKTRTVIYEIPRSQVDPTAANFLIWPPCVEVKRCTGCCNTGNMRCHPSKKQHRTVKVAKVEFASRKKAKLKEVLVRLEDHLECICTSQHHVIEHVEADTGPRTVKNRKKRKHRKKAVAALINKDIQ

Gene Information

Entrez Gene ID
Gene Name
platelet derived growth factor alpha b
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IBA:RefGenome C extracellular space
GO:0016020 IEA:InterPro C membrane
GO:0005161 IBA:RefGenome F platelet-derived growth factor receptor binding
GO:0007596 IBA:RefGenome P blood coagulation
GO:0048008 IBA:RefGenome P platelet-derived growth factor receptor signaling pathway
GO:0070374 IBA:RefGenome P positive regulation of ERK1 and ERK2 cascade
GO:0043406 IBA:RefGenome P positive regulation of MAP kinase activity
GO:0051781 IEA:UniProtKB-KW P positive regulation of cell division
GO:0030335 IBA:RefGenome P positive regulation of cell migration
GO:0008284 IBA:RefGenome P positive regulation of cell proliferation
GO:0014068 IBA:RefGenome P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0031954 IBA:RefGenome P positive regulation of protein autophosphorylation

Domain Information

InterPro Annotations

Accession Description
IPR029034 Cystine-knot_cytokine
IPR000072 PDGF/VEGF_dom
IPR006782 PDGF_N
IPR023581 PD_growth_factor_CS

UniProt Annotations

Entry Information

Gene Name
platelet derived growth factor alpha b
Protein Entry
Q08CD2_DANRE
UniProt ID
Species
Zebrafish

Identical and Related Proteins

Unique RefSeq proteins for LMP012214 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
115529395 RefSeq NP_001070225 230 platelet derived growth factor alpha b precursor

Identical Sequences to LMP012214 proteins

Reference Database Accession Length Protein Name
GI:115529395 GenBank AAI24289.1 230 Platelet derived growth factor alpha b [Danio rerio]

Related Sequences to LMP012214 proteins

Reference Database Accession Length Protein Name
GI:115529395 RefSeq XP_003964708.1 208 PREDICTED: platelet-derived growth factor subunit A-like [Takifugu rubripes]
GI:115529395 RefSeq XP_005163793.1 207 PREDICTED: platelet derived growth factor alpha b isoform X1 [Danio rerio]
GI:115529395 RefSeq XP_005809335.1 208 PREDICTED: platelet-derived growth factor subunit A-like [Xiphophorus maculatus]
GI:115529395 RefSeq XP_007556472.1 208 PREDICTED: platelet-derived growth factor subunit A isoform X1 [Poecilia formosa]
GI:115529395 RefSeq XP_007556473.1 207 PREDICTED: platelet-derived growth factor subunit A isoform X2 [Poecilia formosa]
GI:115529395 RefSeq XP_008414939.1 208 PREDICTED: platelet-derived growth factor subunit A [Poecilia reticulata]