Gene/Proteome Database (LMPD)

LMPD ID
LMP012189
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
lipoyl(octanoyl) transferase 2 (putative)
Gene Symbol
Synonyms
zgc:136925
Alternate Names
putative lipoyltransferase 2, mitochondrial; lipoate-protein ligase B; octanoyltransferase-like; lipoyl/octanoyl transferase; putative octanoyltransferase, mitochondrial; octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase
Chromosome
15
EC Number
2.3.1.181

Proteins

putative lipoyltransferase 2, mitochondrial precursor
Refseq ID NP_001035082
Protein GI 90652835
UniProt ID Q29R99
mRNA ID NM_001039993
Length 224
RefSeq Status PROVISIONAL
MSVTKAAVKAVHLGRISYHSALKIQQQHIQQHLDSSSNIPNTLLLCEHEPVYTIGLRQAPYPPAEEQRLKALGADFCRTNRGGLITFHGPGQLVCYPILNLGCFKKSVRWYVCELERTVIKMCGKFGIKASTSPDTGVWVGDNKICAIGIHCGRYITSHGLALNCNTDMSWFDNIVPCGIVGKGVTSLSQELERDVPPDEAIPKLLEAFTEQFNCTLTYNGSLS

Gene Information

Entrez Gene ID
Gene Name
lipoyl(octanoyl) transferase 2 (putative)
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0016874 IEA:UniProtKB-KW F ligase activity
GO:0033819 IEA:UniProtKB-EC F lipoyl(octanoyl) transferase activity
GO:0016415 IEA:InterPro F octanoyltransferase activity
GO:0006464 IEA:InterPro P cellular protein modification process
GO:0009107 IEA:InterPro P lipoate biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
dre00785 Lipoic acid metabolism
ko00785 Lipoic acid metabolism
dre01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR004143 Biotin/lipoate A/B protein ligase
IPR000544 Octanoyltransferase
IPR020605 Octanoyltransferase, conserved site

UniProt Annotations

Entry Information

Gene Name
lipoyl(octanoyl) transferase 2 (putative)
Protein Entry
LIPT2_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Catalytic Activity Octanoyl-[acyl-carrier-protein] + protein = protein N(6)-(octanoyl)lysine + [acyl-carrier-protein].
Function Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate (By similarity). {ECO:0000250}.
Miscellaneous In the reaction, the free carboxyl group of octanoic acid is attached via an amide linkage to the epsilon- amino group of a specific lysine residue of lipoyl domains of lipoate-dependent enzymes. {ECO:0000250}.
Pathway Protein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier- protein]: step 1/2.
Similarity Belongs to the LipB family. {ECO:0000305}.
Similarity Contains 1 BPL/LPL catalytic domain. {ECO:0000255|PROSITE-ProRule:PRU01067}.
Subcellular Location Mitochondrion {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012189 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90652835 RefSeq NP_001035082 224 putative lipoyltransferase 2, mitochondrial precursor

Identical Sequences to LMP012189 proteins

Reference Database Accession Length Protein Name
GI:90652835 GenBank AAI14310.1 224 Zgc:136925 [Danio rerio]
GI:90652835 SwissProt Q29R99.1 224 RecName: Full=Putative lipoyltransferase 2, mitochondrial; AltName: Full=Lipoate-protein ligase B; AltName: Full=Lipoyl/octanoyl transferase; AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase; Flags: Precursor [Danio rerio]

Related Sequences to LMP012189 proteins

Reference Database Accession Length Protein Name
GI:90652835 GenBank ACO14011.1 226 Octanoyltransferase [Esox lucius]
GI:90652835 GenBank ADO29431.1 226 mitochondrial putative octanoyltransferase [Ictalurus punctatus]
GI:90652835 RefSeq NP_001188014.1 226 mitochondrial putative octanoyltransferase [Ictalurus punctatus]
GI:90652835 RefSeq XP_005157452.1 224 PREDICTED: putative lipoyltransferase 2, mitochondrial isoform X1 [Danio rerio]
GI:90652835 RefSeq XP_005157453.1 224 PREDICTED: putative lipoyltransferase 2, mitochondrial isoform X1 [Danio rerio]
GI:90652835 RefSeq XP_007236839.1 232 PREDICTED: putative lipoyltransferase 2, mitochondrial-like isoform X1 [Astyanax mexicanus]