Gene/Proteome Database (LMPD)

LMPD ID
LMP012138
Gene ID
568117
Species
Danio rerio (Zebrafish)
Gene Name
spinster homolog 2 (Drosophila)
Gene Symbol
spns2
Synonyms
toh; fi20h04; wu:fi20h04; si:dkey-7b17.4
Alternate Names
protein spinster homolog 2; two of hearts; protein two of hearts
Chromosome
5

Proteins

protein spinster homolog 2 isoform 1
Refseq ID NP_001077316
Protein GI 139948643
UniProt ID A2SWM2
mRNA ID NM_001083847
Length 504
RefSeq Status PROVISIONAL
MCVESDGCEIEGCSSSDEVHTLSGSMSPALKSRDLHHCRPGQKFHAALLRCRTPLVAAGILSFGNVLNYMDRYTVAGVLLDIQKQFKVGDSSAGLLQTVFICSFMVAAPIFGYLGDRFNRKIILSCGIFFWSAVTLLSSFITKEYYWLLVLSRCLVGIGESSYSSISPTIMGDLFTNNKRTVMLSVFYLAIPLGSGLGYILGSIAKDAGGHWYWALRVSPMLGLTAGTLILIFVSEPKRGSADQPGGRLKTRTSWVCDMKALAKNRSYVFSSLASAAVSFATGAFGIWIPQYLVRAQVVQKSAESCTYQPCSSRDSLIFGAITCVTGLLGVVIGAVTTRLCRQKTERADPLVCAVSMLGSAIFICLIFVVAKKSIVGAYICIFIGETLLFLNWAITADILMYVVIPTRRATAVAFQGFTSHLLGDAGSPYLIGLISDSLQESYATSEIWQFLSLGYALMLCPFVIVLGGMFFLATALFFLDDRDKAAKQVNQLARPPSTVKVTK
protein spinster homolog 2 isoform 2
Refseq ID NP_001107927
Protein GI 167555142
UniProt ID A9JRX4
mRNA ID NM_001114455
Length 105
RefSeq Status PROVISIONAL
MCVESDGCEIEGCSSSDEVHTLSGSMSPALKSRDLHHCRPGQKFHAALLRCRTPLVAAGILSFGNVLNYMDRYTVAGVLLDIQKQFKVGDSSAGLLQTGNSLIIP

Gene Information

Entrez Gene ID
568117
Gene Name
spinster homolog 2 (Drosophila)
Gene Symbol
spns2
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0006869 IEA:UniProtKB-KW P lipid transport
GO:0055085 IEA:InterPro P transmembrane transport

Domain Information

InterPro Annotations

Accession Description
IPR011701 Major facilitator superfamily
IPR020846 Major facilitator superfamily domain

UniProt Annotations

Entry Information

Gene Name
spinster homolog 2 (Drosophila)
Protein Entry
SPNS2_DANRE
UniProt ID
A9JRX4
Species
Zebrafish

Comments

Comment Type Description
Developmental Stage Induced at the marginal cells of the blastoderm at dome stage. During gastrulation stages, it is predominantly expressed in the extraembryonic yolk syncytial layer (YSL) with a dorsal-to-ventral gradient. Expression in the YSL is strongly detected just below the developing myocardial precursors and maintained throughout segmentation period. This expression continues through early somitogenesis. However, as somitogenesis proceeds, expression domains become evident in the somitic mesoderm and in the endoderm adjacent to the yolk extension. By 24 hpf, it is strongly expressed in a distinct compartment of the somites, in the endoderm, and in the heart. {ECO:0000269|PubMed:19062281, ECO:0000269|PubMed:19074308}.
Disruption Phenotype disrupted formation of the primitive heart tube. {ECO:0000269|PubMed:19062281}.
Function Sphingolipid transporter required for migration of myocardial precursors. Transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. Mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration. {ECO:0000269|PubMed:19062281, ECO:0000269|PubMed:19074308}.
Similarity Belongs to the major facilitator superfamily. Spinster (TC 2.A.1.49) family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012138 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
139948643 RefSeq NP_001077316 504 protein spinster homolog 2 isoform 1
167555142 RefSeq NP_001107927 105 protein spinster homolog 2 isoform 2

Identical Sequences to LMP012138 proteins

Reference Database Accession Length Protein Name
GI:139948643 GenBank ABC88833.1 504 two of hearts [Danio rerio]
GI:167555142 GenBank AAI55833.1 105 Spns2 protein [Danio rerio]

Related Sequences to LMP012138 proteins

Reference Database Accession Length Protein Name
GI:167555142 DBBJ BAH15191.1 504 spinster2 [Danio rerio]
GI:139948643 DBBJ BAH15191.1 504 spinster2 [Danio rerio]
GI:167555142 GenBank ABC88833.1 504 two of hearts [Danio rerio]
GI:167555142 RefSeq NP_001077316.1 504 protein spinster homolog 2 isoform 1 [Danio rerio]
GI:167555142 RefSeq XP_003458078.1 503 PREDICTED: protein spinster homolog 2-like isoform X1 [Oreochromis niloticus]
GI:139948643 RefSeq XP_003458078.1 503 PREDICTED: protein spinster homolog 2-like isoform X1 [Oreochromis niloticus]
GI:139948643 RefSeq XP_003970742.1 503 PREDICTED: protein spinster homolog 2-like [Takifugu rubripes]
GI:139948643 RefSeq XP_005463056.1 506 PREDICTED: protein spinster homolog 2-like isoform X2 [Oreochromis niloticus]
GI:139948643 RefSeq XP_006640892.1 503 PREDICTED: protein spinster homolog 2-like [Lepisosteus oculatus]
GI:167555142 RefSeq XP_006640892.1 503 PREDICTED: protein spinster homolog 2-like [Lepisosteus oculatus]
GI:167555142 SwissProt A2SWM2.2 504 RecName: Full=Protein spinster homolog 2; AltName: Full=Protein two of hearts [Danio rerio]
GI:139948643 SwissProt A2SWM2.2 504 RecName: Full=Protein spinster homolog 2; AltName: Full=Protein two of hearts [Danio rerio]