Gene/Proteome Database (LMPD)
LMPD ID
LMP012129
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
phospholipase D family, member 6
Gene Symbol
Synonyms
fc55d08; wu:fc55d08; zgc:162591
Alternate Names
mitochondrial cardiolipin hydrolase; PLD 6; mitoPLD; phospholipase D6; choline phosphatase 6; mitochondrial phospholipase; phosphatidylcholine-hydrolyzing phospholipase D6; probable phospholipase D family member FLJ33580 homolog
Chromosome
1
EC Number
3.1.-.-
Proteins
| mitochondrial cardiolipin hydrolase | |
|---|---|
| Refseq ID | NP_001082883 |
| Protein GI | 148225260 |
| UniProt ID | A3KNW0 |
| mRNA ID | NM_001089414 |
| Length | 227 |
| RefSeq Status | PROVISIONAL |
| MDVFKQMSFKELMKVLGLGTVAFVLGVEWLNWLTRRLRDSRGPLKEVLFFPSPQVCVEHLFTSHRSFPCACPLPHGIQTSFSRLLEHLLSARTSLEMCIFSFSNMEMSRAILLLHKRGVVVRVVTDRDYMTITGSQIGALRKAGISVRHEMSSAVHMHHKFALVDGRKLISGSLNWTLTAVQSNKENVIITEEPELVRPFQQEFLKLWEASDPANHKLQSKNGQIKK | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase D family, member 6
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005741 | ISS:UniProtKB | C | mitochondrial outer membrane |
| GO:0035755 | ISS:UniProtKB | F | cardiolipin hydrolase activity |
| GO:0004519 | IEA:UniProtKB-KW | F | endonuclease activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0042803 | ISS:UniProtKB | F | protein homodimerization activity |
| GO:0043046 | ISS:UniProtKB | P | DNA methylation involved in gamete generation |
| GO:0030719 | ISS:UniProtKB | P | P granule organization |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0007126 | ISS:UniProtKB | P | meiotic nuclear division |
| GO:0008053 | ISS:UniProtKB | P | mitochondrial fusion |
| GO:0034587 | ISS:UniProtKB | P | piRNA metabolic process |
| GO:0007286 | ISS:UniProtKB | P | spermatid development |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR025202 | Phospholipase D-like domain |
UniProt Annotations
Entry Information
Gene Name
phospholipase D family, member 6
Protein Entry
PLD6_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Domain | In contrast to other members of the phospholipase D family, contains only one PLD phosphodiesterase domain, suggesting that it has a single half-catalytic and requires homodimerization to form a complete active site. {ECO:0000250}. |
| Function | Regulates mitochondrial shape through facilitating mitochondrial fusion. During spermatogenesis, plays a critical role in PIWI-interacting RNA (piRNA) biogenesis (By similarity). piRNAs provide essential protection against the activity of mobile genetic elements. piRNA-mediated transposon silencing is thus critical for maintaining genome stability, in particular in germline cells when transposons are mobilized as a consequence of wide-spread genomic demethylation. Has been shown to be a backbone-non-specific, single strand-specific nuclease, cleaving either RNA or DNA substrates with similar affinity (By similarity). Produces 5' phosphate and 3' hydroxyl termini, suggesting it could directly participate in the processing of primary piRNA transcripts (By similarity). Has been proposed to act as a cardiolipin hydrolase to generate phosphatidic acid at mitochondrial surface. Although it cannot be excluded that it can act as a phospholipase in some circumstances, this activity could not be confirmed (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the phospholipase D family. MitoPLD/Zucchini subfamily. {ECO:0000305}. |
| Similarity | Contains 1 PLD phosphodiesterase domain. {ECO:0000305}. |
| Subcellular Location | Mitochondrion outer membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. |
| Subunit | Homodimer. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012129 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 148225260 | RefSeq | NP_001082883 | 227 | mitochondrial cardiolipin hydrolase |
Identical Sequences to LMP012129 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:148225260 | GenBank | AAI34036.1 | 227 | Zgc:162591 protein [Danio rerio] |
Related Sequences to LMP012129 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:148225260 | RefSeq | XP_006631688.1 | 219 | PREDICTED: mitochondrial cardiolipin hydrolase-like [Lepisosteus oculatus] |
| GI:148225260 | RefSeq | XP_007246789.1 | 235 | PREDICTED: mitochondrial cardiolipin hydrolase-like [Astyanax mexicanus] |
| GI:148225260 | RefSeq | XP_008275790.1 | 221 | PREDICTED: mitochondrial cardiolipin hydrolase [Stegastes partitus] |
| GI:148225260 | RefSeq | XP_008413835.1 | 211 | PREDICTED: mitochondrial cardiolipin hydrolase [Poecilia reticulata] |
| GI:148225260 | RefSeq | XP_008413842.1 | 211 | PREDICTED: mitochondrial cardiolipin hydrolase [Poecilia reticulata] |
| GI:148225260 | SwissProt | A3KNW0.2 | 227 | RecName: Full=Mitochondrial cardiolipin hydrolase; AltName: Full=Choline phosphatase 6; AltName: Full=Mitochondrial phospholipase; Short=MitoPLD; AltName: Full=Phosphatidylcholine-hydrolyzing phospholipase D6; AltName: Full=Phospholipase D6; Short=PLD 6 [Danio rerio] |