Gene/Proteome Database (LMPD)
LMPD ID
LMP012108
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
vitamin D (1,25- dihydroxyvitamin D3) receptor b
Gene Symbol
Synonyms
NR1I1-B; VDRbeta; gb:dq017633
Alternate Names
vitamin D3 receptor B; VDR-B; vitamin D receptor b; vitamin D receptor beta; 1,25-dihydroxyvitamin D3 receptor B; vitamin D (1,25-dihydroxyvitamin D3) receptor; nuclear receptor subfamily 1 group I member 1-B
Chromosome
6
Proteins
| vitamin D3 receptor B | |
|---|---|
| Refseq ID | NP_001153457 |
| Protein GI | 229606097 |
| UniProt ID | Q1L673 |
| mRNA ID | NM_001159985 |
| Length | 422 |
| RefSeq Status | VALIDATED |
| MESAVSTSTQVPDEFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKASFTCPFNGSCTITKDNRRHCQACRLKRCLDIGMMKEFILTDEEVQRKKELIQRRKDEEAHREAQKPRLSDEQRNIIDTLVDAHHKTYDDSYSDFSRFRPPVREGPVTRSASRAASLHSLSDASSDSFSHSPESGDRKMNLSNLLMMYQEQGLSSSPDSKEEDGSSLSMLPHLADLVSYSIQKVIGFAKMIPGFRELTAEDQIALLKSSAIEVIMLRSNQSFSLEDMSWSCGGPEFKYCVNDVTKAGHTLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPDRPGVQDHVRVEALQDKVSEVLQAYIRAHHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGGQVT | |
Gene Information
Entrez Gene ID
Gene Name
vitamin D (1,25- dihydroxyvitamin D3) receptor b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0008434 | IEA:InterPro | F | calcitriol receptor activity |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6176482 | Nuclear Receptor transcription pathway |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Gene Name
vitamin D (1,25- dihydroxyvitamin D3) receptor b
Protein Entry
VDRB_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. {ECO:0000250}. |
| Function | Nuclear hormone receptor. Transcription factor that mediates the action of vitamin D3 by controlling the expression of hormone sensitive genes. Regulates transcription of hormone sensitive genes via its association with the WINAC complex, a chromatin-remodeling complex. Plays a central role in calcium homeostasis (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the nuclear hormone receptor family. {ECO:0000305}. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00407}. |
| Subcellular Location | Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407}. |
| Subunit | Interacts with ncoa1 and possibly other coactivators, leading to a strong increase of transcription of target genes. {ECO:0000250}. |
| Tissue Specificity | Detected in embryo 24 to 48 hours after fertilization, and in intestinal bulb. {ECO:0000269|PubMed:17997606}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012108 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 229606097 | RefSeq | NP_001153457 | 422 | vitamin D3 receptor B |
Identical Sequences to LMP012108 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:229606097 | RefSeq | XP_005166104.1 | 422 | PREDICTED: vitamin D3 receptor B isoform X1 [Danio rerio] |
| GI:229606097 | SwissProt | Q1L673.2 | 422 | RecName: Full=Vitamin D3 receptor B; Short=VDR-B; AltName: Full=1,25-dihydroxyvitamin D3 receptor B; AltName: Full=Nuclear receptor subfamily 1 group I member 1-B [Danio rerio] |
Related Sequences to LMP012108 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:229606097 | GenBank | AAY85288.1 | 419 | VDR-B, partial [Danio rerio] |
| GI:229606097 | GenBank | AIM62162.1 | 422 | vitamin D receptor beta [Danio rerio] |
| GI:229606097 | RefSeq | XP_007249184.1 | 421 | PREDICTED: vitamin D3 receptor B-like isoform X1 [Astyanax mexicanus] |
| GI:229606097 | RefSeq | XP_007249185.1 | 421 | PREDICTED: vitamin D3 receptor B-like isoform X2 [Astyanax mexicanus] |
| GI:229606097 | RefSeq | XP_007249186.1 | 421 | PREDICTED: vitamin D3 receptor B-like isoform X3 [Astyanax mexicanus] |
| GI:229606097 | RefSeq | XP_007249187.1 | 421 | PREDICTED: vitamin D3 receptor B-like isoform X4 [Astyanax mexicanus] |