Gene/Proteome Database (LMPD)
Proteins
| probable palmitoyltransferase ZDHHC4 | |
|---|---|
| Refseq ID | NP_956343 |
| Protein GI | 156447031 |
| UniProt ID | F1QAM1 |
| mRNA ID | NM_200049 |
| Length | 345 |
| RefSeq Status | VALIDATED |
| MDFLTLFGIYVAVVLTCIALVCKYSGHQQTPLGQLVGAFTRIVSPCIPQWLQSICYRTMHRLFHQRNNFFLYLHLLLEVVVYGEFTYEVFGFCLDMGSSSLSLCVPYILLALKSCLFYLCCSRDPGTLTKSNLSAHLKIYQYDEKLFQQGMKCSTCQLIKPARSKHCRVCNRCVQRFDHHCVWVNNCIGAQNTRYFMLYLLSVCAMAGNIAVLTTDMLLQTVLRTGLLHAHYIDEQGIQQPAGPLFIIQHLFLTFPRIVFMLGFLVFVFFLLAGYCLFHFYLVLVNQTSNEWFKAKGHNCQHCHPYSGHNCRTSYNPFRGFYHRGILKNIGEIFWPLRPVQKKEN | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 4
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 4
Protein Entry
F1QAM1_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012083 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 156447031 | RefSeq | NP_956343 | 345 | probable palmitoyltransferase ZDHHC4 |
Identical Sequences to LMP012083 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP012083 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:156447031 | GenBank | AAI52670.1 | 250 | Zgc:64155 protein [Danio rerio] |
| GI:156447031 | GenBank | AAI54786.1 | 345 | Zgc:64155 [Danio rerio] |
| GI:156447031 | GenBank | AAI57611.1 | 344 | LOC100135312 protein, partial [Xenopus (Silurana) tropicalis] |
| GI:156447031 | GenBank | AAH53285.2 | 345 | Zgc:64155 [Danio rerio] |
| GI:156447031 | RefSeq | XP_007251276.1 | 345 | PREDICTED: probable palmitoyltransferase ZDHHC4 isoform X1 [Astyanax mexicanus] |
| GI:156447031 | RefSeq | XP_007251277.1 | 345 | PREDICTED: probable palmitoyltransferase ZDHHC4 isoform X2 [Astyanax mexicanus] |