Gene/Proteome Database (LMPD)
Proteins
| palmitoyltransferase ZDHHC9 | |
|---|---|
| Refseq ID | NP_001103496 |
| Protein GI | 158518002 |
| UniProt ID | A7YT88 |
| mRNA ID | NM_001110026 |
| Length | 382 |
| RefSeq Status | PROVISIONAL |
| MITRKITRKWEKLPGKNTFCCDGRVMMARQKGVFYLTLFLIVGTCSLFFAFECPYLAVHLSPAIPVFAVLLFVFVMAMLLRTSFSDPGVLPRALPEEANFIEMEIEAANGNVLAGQRPPPRIKNVQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVDRFDHHCPWVGNCVGKRNYRYFYLFTLSLSLLTIYIFAFDIVHVVLRSVDSGFVNTLKETPGTVLEVLVCFFTLWSVVGLTGFHTYLISLNQTTNEDIKGSWSGKNRVQNPYSHKNIIKNCCEVLCGPTYPSVLDRRGLMLEDSCSSAPSNGATTVPLNKSSNPATQTTKSSAPLIPNEHTPDEAKPSIGSGTQKSSSSPKEEKPSSPISPNAVAPAVIKESTH | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 9
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 9
Protein Entry
A7YT88_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012066 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 158518002 | RefSeq | NP_001103496 | 382 | palmitoyltransferase ZDHHC9 |
Identical Sequences to LMP012066 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:158518002 | GenBank | AAI15337.1 | 382 | Zgc:136936 protein [Danio rerio] |
Related Sequences to LMP012066 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:158518002 | RefSeq | XP_003445330.1 | 378 | PREDICTED: palmitoyltransferase ZDHHC9-like [Oreochromis niloticus] |
| GI:158518002 | RefSeq | XP_006781272.1 | 377 | PREDICTED: palmitoyltransferase ZDHHC9-like [Neolamprologus brichardi] |
| GI:158518002 | RefSeq | XP_007254502.1 | 389 | PREDICTED: palmitoyltransferase ZDHHC9 [Astyanax mexicanus] |
| GI:158518002 | RefSeq | XP_008273986.1 | 393 | PREDICTED: palmitoyltransferase ZDHHC9 isoform X2 [Stegastes partitus] |
| GI:158518002 | RefSeq | XP_008273996.1 | 386 | PREDICTED: palmitoyltransferase ZDHHC9 isoform X3 [Stegastes partitus] |
| GI:158518002 | RefSeq | XP_008418874.1 | 381 | PREDICTED: palmitoyltransferase ZDHHC9 [Poecilia reticulata] |