Gene/Proteome Database (LMPD)
Proteins
| annexin A13 | |
|---|---|
| Refseq ID | NP_001019585 |
| Protein GI | 66773118 |
| UniProt ID | Q4VBH6 |
| mRNA ID | NM_001024414 |
| Length | 316 |
| RefSeq Status | PROVISIONAL |
| MGNVQPTITPFEDFDVVADIKTIRKACKGMGTDEETIISILANRSAAQRLEIKQAYFEKYDDDLEEVLKNELTGNFENAVIAMLDPPNVFMAKELRRAMKGAGTDEDVLVEILCTSTNQDILNCKEAYLQVHERDLEADIEDDTSGEVRNLLVSLLQADRDEAYEVDEALAEQDATSLIEAGEGRFGTDESTFTYILTHRNYLQLQATFKIYETLSGTDILDAIDSEATGTLKDCYVTLVRCAKNPQLYFARRLNAAMKGAGTDEETLIRIIVGRSEVDLETIKDMYLEKYDVTLKDALSSECGGDFKRLLIEILH | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0005544 | IEA:UniProtKB-KW | F | calcium-dependent phospholipid binding |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Domain | A pair of annexin repeats may form one binding site for calcium and phospholipid. |
| Similarity | Belongs to the annexin family. |
| Similarity | Contains 4 annexin repeats. |
| Similarity | Contains annexin repeats. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012001 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 66773118 | RefSeq | NP_001019585 | 316 | annexin A13 |
Identical Sequences to LMP012001 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66773118 | GenBank | AAH95812.1 | 316 | Zgc:112421 [Danio rerio] |
Related Sequences to LMP012001 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66773118 | GenBank | AHH39923.1 | 316 | Annexin A13 [Ictalurus punctatus] |
| GI:66773118 | RefSeq | XP_003453332.1 | 316 | PREDICTED: annexin A13-like [Oreochromis niloticus] |
| GI:66773118 | RefSeq | XP_005171227.1 | 315 | PREDICTED: annexin A13 isoform X1 [Danio rerio] |
| GI:66773118 | RefSeq | XP_005804647.1 | 316 | PREDICTED: annexin A13-like [Xiphophorus maculatus] |
| GI:66773118 | RefSeq | XP_007250683.1 | 316 | PREDICTED: annexin A13-like [Astyanax mexicanus] |
| GI:66773118 | RefSeq | XP_007540267.1 | 316 | PREDICTED: annexin A13-like [Poecilia formosa] |