Gene/Proteome Database (LMPD)

LMPD ID
LMP011951
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
metallophosphoesterase 1
Gene Symbol
Synonyms
zgc:112219
Alternate Names
metallophosphoesterase 1; post-GPI attachment to proteins factor 5
Chromosome
24
EC Number
3.1.-.-

Proteins

metallophosphoesterase 1
Refseq ID NP_001017701
Protein GI 62955371
UniProt ID Q566Y9
mRNA ID NM_001017701
Length 381
RefSeq Status PROVISIONAL
MTLVFGSSCRLAVTLIFAFVSVFVFCEYVIYYLVILRCSWPLLEIEDSHSPLRALFLSDTHLLGAIRGHWLDKLRREWQMERAFQTSMWLLNPEVVFILGDVFDEGKWSTSQDWEDDVRRFKRIFRHPVDTKLVVLVGNHDIGFHHEMTKQKLERFEQVFNVTSARILTIKGVNFLLVNSVALHGDHCPICQHVEEELQKLSHALNCSIQGAQHNGQCKNAARFAPAAPVLLQHYPLYRVSDAMCTGVDTAPLDEQYLLFQERYDVISKNASKKLLWWFKPRLILSGHTHNGCEVLHEKLYPEISVPSFSWRNRNNPSFVLGTFSQSEFQLSKCFLPEERTVLVVYCSSCLIIALITLIHLKMFRNSLQFTNNLIGKHKTL

Gene Information

Entrez Gene ID
Gene Name
metallophosphoesterase 1
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0005801 ISS:UniProtKB C cis-Golgi network
GO:0070971 ISS:UniProtKB C endoplasmic reticulum exit site
GO:0005793 ISS:UniProtKB C endoplasmic reticulum-Golgi intermediate compartment
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0034235 ISS:UniProtKB F GPI anchor binding
GO:0030145 ISS:UniProtKB F manganese ion binding
GO:0008081 ISS:UniProtKB F phosphoric diester hydrolase activity
GO:0006888 ISS:UniProtKB P ER to Golgi vesicle-mediated transport
GO:0006506 ISS:UniProtKB P GPI anchor biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR004843 Calcineurin-like phosphoesterase domain, apaH type
IPR029052 Metallo-dependent phosphatase-like

UniProt Annotations

Entry Information

Gene Name
metallophosphoesterase 1
Protein Entry
MPPE1_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Note=Binds 2 manganese ions per subunit. {ECO:0000250};
Function Metallophosphoesterase required for transport of GPI- anchor proteins from the endoplasmic reticulum to the Golgi. Acts in lipid remodeling steps of GPI-anchor maturation by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second Man (Man2) of the GPI intermediate, an essential step for efficient transport of GPI-anchor proteins (By similarity). {ECO:0000250}.
Similarity Belongs to the metallophosphoesterase superfamily. MPPE1 family. {ECO:0000305}.
Subcellular Location Golgi apparatus, cis-Golgi network membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Endoplasmic reticulum-Golgi intermediate compartment membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Note=Also localizes to endoplasmic reticulum exit site. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011951 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
62955371 RefSeq NP_001017701 381 metallophosphoesterase 1

Identical Sequences to LMP011951 proteins

Reference Database Accession Length Protein Name
GI:62955371 GenBank AAH93272.1 381 Metallophosphoesterase 1 [Danio rerio]
GI:62955371 SwissProt Q566Y9.1 381 RecName: Full=Metallophosphoesterase 1; AltName: Full=Post-GPI attachment to proteins factor 5 [Danio rerio]

Related Sequences to LMP011951 proteins

Reference Database Accession Length Protein Name
GI:62955371 GenBank ADO29181.1 380 metallophosphoesterase 1 [Ictalurus punctatus]
GI:62955371 RefSeq NP_001187832.1 380 metallophosphoesterase 1 [Ictalurus punctatus]
GI:62955371 RefSeq XP_005802048.1 393 PREDICTED: metallophosphoesterase 1-like [Xiphophorus maculatus]
GI:62955371 RefSeq XP_006634017.1 389 PREDICTED: metallophosphoesterase 1-like [Lepisosteus oculatus]
GI:62955371 RefSeq XP_007260147.1 367 PREDICTED: metallophosphoesterase 1 [Astyanax mexicanus]
GI:62955371 RefSeq XP_007567452.1 393 PREDICTED: metallophosphoesterase 1-like [Poecilia formosa]