Gene/Proteome Database (LMPD)

LMPD ID
LMP011904
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
CTD nuclear envelope phosphatase 1b
Gene Symbol
Synonyms
dullardl; zgc:101656
Alternate Names
CTD nuclear envelope phosphatase 1B; ctdnep1l; dullard-like protein; dullard homolog, like; serine/threonine-protein phosphatase dullard-B
Chromosome
7
EC Number
3.1.3.16

Proteins

CTD nuclear envelope phosphatase 1B
Refseq ID NP_001007441
Protein GI 55925373
UniProt ID Q5U3T3
mRNA ID NM_001007440
Length 245
RefSeq Status PROVISIONAL
MLKTRQCLLGVRTFHGVTSRIWSFFLYILRKHIRTIIQYQTVRYDILSLSPISRNRLNNVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNKAILKRRYYRQHCTLDSGSYIKDLSVVHDDLSSVVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFPADVRSVLSRNLHQHRLW

Gene Information

Entrez Gene ID
Gene Name
CTD nuclear envelope phosphatase 1b
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0071595 ISS:UniProtKB C Nem1-Spo7 phosphatase complex
GO:0005737 ISS:UniProtKB C cytoplasm
GO:0005789 ISS:UniProtKB C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005635 ISS:UniProtKB C nuclear envelope
GO:0031965 ISS:UniProtKB C nuclear membrane
GO:0004722 ISS:UniProtKB F protein serine/threonine phosphatase activity
GO:0006998 ISS:UniProtKB P nuclear envelope organization
GO:0010867 ISS:UniProtKB P positive regulation of triglyceride biosynthetic process
GO:0006470 ISS:UniProtKB P protein dephosphorylation

Domain Information

InterPro Annotations

Accession Description
IPR011948 Dullard phosphatase domain, eukaryotic
IPR023214 HAD-like domain
IPR004274 NLI interacting factor

UniProt Annotations

Entry Information

Gene Name
CTD nuclear envelope phosphatase 1b
Protein Entry
CNEPB_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Catalytic Activity [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.
Function Serine/threonine protein phosphatase that may dephosphorylate and activate lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling (By similarity). {ECO:0000250}.
Similarity Belongs to the dullard family. {ECO:0000305}.
Similarity Contains 1 FCP1 homology domain. {ECO:0000255|PROSITE- ProRule:PRU00336}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. Nucleus membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011904 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
55925373 RefSeq NP_001007441 245 CTD nuclear envelope phosphatase 1B

Identical Sequences to LMP011904 proteins

Reference Database Accession Length Protein Name
GI:55925373 GenBank AAH85403.1 245 Dullard homolog, like [Danio rerio]
GI:55925373 SwissProt Q5U3T3.1 245 RecName: Full=CTD nuclear envelope phosphatase 1B; AltName: Full=Dullard-like protein; AltName: Full=Serine/threonine-protein phosphatase dullard-B [Danio rerio]

Related Sequences to LMP011904 proteins

Reference Database Accession Length Protein Name
GI:55925373 GenBank AAH85649.1 245 Dullard homolog [Danio rerio]
GI:55925373 RefSeq NP_001007310.1 245 CTD nuclear envelope phosphatase 1A [Danio rerio]
GI:55925373 RefSeq XP_005165199.1 245 PREDICTED: CTD nuclear envelope phosphatase 1A isoform X1 [Danio rerio]
GI:55925373 RefSeq XP_005169106.1 248 PREDICTED: CTD nuclear envelope phosphatase 1B isoform X1 [Danio rerio]
GI:55925373 RefSeq XP_007551309.1 247 PREDICTED: CTD nuclear envelope phosphatase 1 [Poecilia formosa]
GI:55925373 SwissProt Q5U395.1 245 RecName: Full=CTD nuclear envelope phosphatase 1A; AltName: Full=Serine/threonine-protein phosphatase dullard-A [Danio rerio]