Gene/Proteome Database (LMPD)
Proteins
| zinc finger, DHHC-type containing 15a | |
|---|---|
| Refseq ID | NP_001006003 |
| Protein GI | 54400508 |
| UniProt ID | Q5XJ21 |
| mRNA ID | NM_001006003 |
| Length | 328 |
| RefSeq Status | PROVISIONAL |
| MLLPACLRRCARLLFWIPVLVVIVVVMWSYYAYVVHFCWILLSSAIQRVVFLCLFHLCFGMFSWSFWKAVSTPPSSPSVEFQFSTSDSLLYELERDDVEKSPILLEISQKLPVHTRTATGAIRFCHHCQLIKPDRCHHCSVCQTCVLKMDHHCLWLNNCMGFSNYKFFMLFLLYSLLYCLLIVSTVTPTVIQLWRGRLFDSCVELHVLFLTLVSAIFAITLCFLLIFHIWLLTSNKTTLEWLSVPFFVNGPGSKAFDVGVQANFLQVFGKKKRLWLFPVFSSEGDGHSFPLSCQMSSHGPPVMNGHERCATQRTVASPKESAVIIAVD | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 15a
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 15a
Protein Entry
Q5XJ21_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011878 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 54400508 | RefSeq | NP_001006003 | 328 | zinc finger, DHHC-type containing 15a |
Identical Sequences to LMP011878 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:54400508 | GenBank | AAH83491.1 | 328 | Zgc:103780 [Danio rerio] |
Related Sequences to LMP011878 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:54400508 | RefSeq | XP_005795387.1 | 334 | PREDICTED: palmitoyltransferase ZDHHC15-like [Xiphophorus maculatus] |
| GI:54400508 | RefSeq | XP_007257571.1 | 317 | PREDICTED: palmitoyltransferase ZDHHC15-like [Astyanax mexicanus] |
| GI:54400508 | RefSeq | XP_007548444.1 | 336 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Poecilia formosa] |
| GI:54400508 | RefSeq | XP_008418289.1 | 336 | PREDICTED: palmitoyltransferase ZDHHC15 [Poecilia reticulata] |
| GI:54400508 | RefSeq | XP_009299576.1 | 326 | PREDICTED: zinc finger, DHHC-type containing 15a isoform X1 [Danio rerio] |
| GI:54400508 | RefSeq | XP_009299577.1 | 195 | PREDICTED: zinc finger, DHHC-type containing 15a isoform X2 [Danio rerio] |