Gene/Proteome Database (LMPD)
Proteins
| palmitoyltransferase ZDHHC7 | |
|---|---|
| Refseq ID | NP_001002602 |
| Protein GI | 50540270 |
| UniProt ID | Q6DHI1 |
| mRNA ID | NM_001002602 |
| Length | 299 |
| RefSeq Status | PROVISIONAL |
| MQSSGQRLRDVEQHQPLLSGGEEEVTAGRVWFIQDSCGMVCAFMTWSLVMYAEFVVNFVMLLPSKNFWYTLINGVAFNFLAVLALTSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCSIKPERAHHCSICKRCIRKMDHHCPWVNNCVGENNQRFFVLFTMYIASISLHALCLSGFHFFTCVKVQWNECSDFSPPVAVMLLIFLCLEALLFLTFTAVMFGTQIHSICNDETEIERLKNEKPTWERRVRWDGMKAVFGGPPSLLWFNPFAGLRLRMLMVRARRSGAEFSV | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 7
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 7
Protein Entry
Q6DHI1_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011824 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 50540270 | RefSeq | NP_001002602 | 299 | palmitoyltransferase ZDHHC7 |
Identical Sequences to LMP011824 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50540270 | GenBank | AAH75993.1 | 299 | Zgc:92305 [Danio rerio] |
Related Sequences to LMP011824 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50540270 | GenBank | AHH40759.1 | 300 | Palmitoyltransferase ZDHHC7 [Ictalurus punctatus] |
| GI:50540270 | RefSeq | XP_003977467.1 | 301 | PREDICTED: palmitoyltransferase ZDHHC7-like [Takifugu rubripes] |
| GI:50540270 | RefSeq | XP_005796228.1 | 303 | PREDICTED: palmitoyltransferase ZDHHC7-like [Xiphophorus maculatus] |
| GI:50540270 | RefSeq | XP_007244096.1 | 300 | PREDICTED: palmitoyltransferase ZDHHC7-like [Astyanax mexicanus] |
| GI:50540270 | RefSeq | XP_007559129.1 | 320 | PREDICTED: palmitoyltransferase ZDHHC7 [Poecilia formosa] |
| GI:50540270 | RefSeq | XP_008287113.1 | 320 | PREDICTED: palmitoyltransferase ZDHHC7-like [Stegastes partitus] |