Gene/Proteome Database (LMPD)
Proteins
| gastrotropin | |
|---|---|
| Refseq ID | NP_001002076 |
| Protein GI | 50344806 |
| UniProt ID | Q6IMW5 |
| mRNA ID | NM_001002076 |
| Length | 131 |
| RefSeq Status | VALIDATED |
| MAFNGKWETESQEGYEPFCKLIGIPDDVIAKGRDFKLVTEIVQNGDDFTWTQYYPNNHVVTNKFIVGKESDMETVGGKKFKGIVSMEGGKLTISFPKYQQTTEISGGKLVETSTASGAQGTAVLVRTSKKV | |
Gene Information
Entrez Gene ID
Gene Name
fatty acid binding protein 6, ileal (gastrotropin)
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0032052 | IDA:ZFIN | F | bile acid binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
fatty acid binding protein 6, ileal (gastrotropin)
Protein Entry
Q6IMW5_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011795 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 50344806 | RefSeq | NP_001002076 | 131 | gastrotropin |
Identical Sequences to LMP011795 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50344806 | GenBank | AAH72553.1 | 131 | Fatty acid binding protein 6, ileal (gastrotropin) [Danio rerio] |
Related Sequences to LMP011795 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50344806 | GenBank | ACD37356.1 | 131 | fatty acid-binding protein 6 [Danio rerio] |
| GI:50344806 | GenBank | ACD37357.1 | 131 | fatty acid-binding protein 6 [Danio rerio] |
| GI:50344806 | GenBank | ACD37358.1 | 131 | fatty acid-binding protein 6 [Danio rerio] |
| GI:50344806 | GenBank | ACD37359.1 | 131 | fatty acid-binding protein 6 [Danio rerio] |
| GI:50344806 | GenBank | ACD37360.1 | 131 | fatty acid-binding protein 6 [Danio rerio] |
| GI:50344806 | PDB | 3ELZ | 138 | Chain A, Crystal Structure Of Zebrafish Ileal Bile Acid-Bindin Protein Complexed With Cholic Acid (Crystal Form A). |