Gene/Proteome Database (LMPD)
Proteins
| cannabinoid receptor 1 | |
|---|---|
| Refseq ID | NP_997985 |
| Protein GI | 47086397 |
| UniProt ID | Q7T3Q3 |
| mRNA ID | NM_212820 |
| Length | 475 |
| RefSeq Status | PROVISIONAL |
| MLFPASKSDVKSVLDGVAETTFRTITSGLQYIGSNDIGYDDHIIDGDFSKSGYPLPKPFAAYRRSSFADKVAPDEELIVKGLPFYPTNSSDVFGNWSHAEDGSLQCGENFMDMECFMILTPSQQLAIAVLSLTLGTFTVLENLVVLCVILQSRTLRCRPSYHFIGSLAIADLLGSVIFVYSFLDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYVSIHRPLSYRRIVTRTKAVIAFCMMWAISIIIAVLPLLGWNCKRLNSVCSDIFPLIDENYLMFWIGVTSVLVLFIIYAYMYILWKAHHHAVRMLRRTSQKSLVVHSADGTKVQTPRPDQARMDIRLAKTLVLILVVLVICWGPLLAIMVYDLFWRMGDNIKTVFAFCSMLTLLNSTVNPIIYALRSKDLRRAFLAACQGCRGTSTTPLQLDNSLESDCHRNQHRAAESCVKTTVKIAKLTMSVSAETSAEAV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004949 | IEA:InterPro | F | cannabinoid receptor activity |
| GO:0007413 | IMP:ZFIN | P | axonal fasciculation |
| GO:0007409 | IMP:ZFIN | P | axonogenesis |
| GO:0008610 | IMP:ZFIN | P | lipid biosynthetic process |
| GO:2000253 | IMP:ZFIN | P | positive regulation of feeding behavior |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP011732 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47086397 | RefSeq | NP_997985 | 475 | cannabinoid receptor 1 |
Identical Sequences to LMP011732 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086397 | GenBank | AAN46748.1 | 475 | cannabinoid receptor-like protein cb1-zf [Danio rerio] |
Related Sequences to LMP011732 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086397 | GenBank | AHH40250.1 | 471 | Cannabinoid receptor type 1A [Ictalurus punctatus] |
| GI:47086397 | RefSeq | XP_004550540.1 | 469 | PREDICTED: cannabinoid receptor type 1A-like isoform X2 [Maylandia zebra] |
| GI:47086397 | RefSeq | XP_004550541.1 | 469 | PREDICTED: cannabinoid receptor type 1A-like isoform X3 [Maylandia zebra] |
| GI:47086397 | RefSeq | XP_005475071.1 | 469 | PREDICTED: cannabinoid receptor type 1A-like isoform X1 [Oreochromis niloticus] |
| GI:47086397 | RefSeq | XP_005475072.1 | 469 | PREDICTED: cannabinoid receptor type 1A-like isoform X2 [Oreochromis niloticus] |
| GI:47086397 | RefSeq | XP_007255274.1 | 471 | PREDICTED: cannabinoid receptor type 1A-like [Astyanax mexicanus] |