Gene/Proteome Database (LMPD)
Proteins
| rab proteins geranylgeranyltransferase component A 2 | |
|---|---|
| Refseq ID | NP_982286 |
| Protein GI | 44917599 |
| UniProt ID | Q6RFG0 |
| mRNA ID | NM_203461 |
| Length | 666 |
| RefSeq Status | PROVISIONAL |
| MAAEDLPSQFDVVILGTGLTESVIAAACSRVGQSVLHLDRRNYYAGNWASFTFNGLLSWIEEYKNQQELQITESEQEWRSLIEDGEEAVPLNSVDSSISNLEVFCYASEEEEQEEETKDLLTCPNAETVSEETNSDSTETQDTVTSDDVTESNVKVQNEENEDSAPKEQLHASDISEHSQSVEEKQPNRSPADPPAELQKKITYQKLLKEGRRFNIDLVSKLMYSRGALVDLLIKSNVSRYAEFKNIGRILTCRNGKVEQVPCSRADVFASKQLTVVEKRMLMKFLTFCLDFEQHPEEYQDYSEKPFSEFLKNKKLTENLQDFVLLSIAMVTQQTLTEEGLKATQHFLRCLGRYGNTPFLFPLYGLGEIPQCFCRMCAVFGGIYCLRHSVQCLVVDKESNKVKAVIDTRGQKIGCSHFVVEDSYIREEQRESIDYRQISRAVLITDRSVLPSESDQQISLVTVPPVESSGPAVRMVELCSSSMTCMPGTCLVHLTCSSSGTAQQDLAPVVSQLFHIPTTPGEDPSEGTGEISKPAVLWVMYFNMRDTSAMDSSCYSLPSNVHVCTGPDAGLGSDYSIKLAESVFHCLLPDEEFCPPAPNPEDIIYDGDAPQAEGRGFDESNDTEANKSQAEEEGTTNETNPENSEAAEMDSVAQETTLDTNPPSEE | |
Gene Information
Entrez Gene ID
Gene Name
choroideremia (Rab escort protein 1)
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005968 | IEA:InterPro | C | Rab-protein geranylgeranyltransferase complex |
| GO:0004663 | IMP:ZFIN | F | Rab geranylgeranyltransferase activity |
| GO:0042491 | IMP:ZFIN | P | auditory receptor cell differentiation |
| GO:0050910 | IMP:ZFIN | P | detection of mechanical stimulus involved in sensory perception of sound |
| GO:0006886 | IEA:InterPro | P | intracellular protein transport |
| GO:0050935 | IMP:ZFIN | P | iridophore differentiation |
| GO:0008152 | IMP:GOC | P | metabolic process |
| GO:0060042 | IMP:ZFIN | P | retina morphogenesis in camera-type eye |
| GO:0048798 | IMP:ZFIN | P | swim bladder inflation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
choroideremia (Rab escort protein 1)
Protein Entry
Q6RFG0_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011721 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 44917599 | RefSeq | NP_982286 | 666 | rab proteins geranylgeranyltransferase component A 2 |
Identical Sequences to LMP011721 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:44917599 | GenBank | AAR88081.1 | 666 | Rab escort protein 1 [Danio rerio] |
Related Sequences to LMP011721 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:44917599 | EMBL | CDQ81206.1 | 676 | unnamed protein product [Oncorhynchus mykiss] |
| GI:44917599 | GenBank | AAH96773.1 | 666 | Chm protein [Danio rerio] |
| GI:44917599 | GenBank | AAI54208.1 | 666 | Choroideremia [Danio rerio] |
| GI:44917599 | GenBank | AAI64561.1 | 666 | Chm protein [Danio rerio] |
| GI:44917599 | RefSeq | XP_005284585.1 | 660 | PREDICTED: rab proteins geranylgeranyltransferase component A 1 isoform X1 [Chrysemys picta bellii] |
| GI:44917599 | RefSeq | XP_006632852.1 | 711 | PREDICTED: rab proteins geranylgeranyltransferase component A 1-like [Lepisosteus oculatus] |