Gene/Proteome Database (LMPD)

LMPD ID
LMP011695
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
sigma non-opioid intracellular receptor 1
Gene Symbol
Synonyms
oprs1; zgc:56378
Alternate Names
sigma non-opioid intracellular receptor 1; sigma1R; sigma1-receptor; opioid receptor, sigma 1; sigma 1-type opioid receptor
Chromosome
10

Proteins

sigma non-opioid intracellular receptor 1
Refseq ID NP_957271
Protein GI 41055792
UniProt ID Q7ZWG9
mRNA ID NM_200977
Length 222
RefSeq Status PROVISIONAL
MSLIRTILKLVVVVGFLSLTVQFIRHWMANKQYVFTKEEVAKLAKQYAGQDHEQAFSKVVVELRRRYPGHILPDEDLQWVFVNAGGWMGSMCLLHASLTEYVLLFGTAVDTGGHSGRYWAEISDTIISGTFRQWKEGTTKSETYYPGDTIVHSAGEATSVQWSSGTWMVEYGRGFIPSTLGFALADTMFSTQDFLTLFYTARVYVKGMILEASTFLTESGVL

Gene Information

Entrez Gene ID
Gene Name
sigma non-opioid intracellular receptor 1
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0006869 IEA:UniProtKB-KW P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR006716 ERG2/sigma1 receptor-like
IPR028545 Sigma non-opioid intracellular receptor 1

UniProt Annotations

Entry Information

Gene Name
sigma non-opioid intracellular receptor 1
Protein Entry
SGMR1_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Function May function in lipid transport from the endoplasmic reticulum and be involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. May regulate calcium efflux at the endoplasmic reticulum (By similarity). {ECO:0000250}.
Similarity Belongs to the ERG2 family. {ECO:0000305}.
Subcellular Location Nucleus inner membrane. Nucleus outer membrane {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000250}. Cell membrane {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011695 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
41055792 RefSeq NP_957271 222 sigma non-opioid intracellular receptor 1

Identical Sequences to LMP011695 proteins

Reference Database Accession Length Protein Name
GI:41055792 GenBank AAH49416.1 222 Sigma non-opioid intracellular receptor 1 [Danio rerio]
GI:41055792 SwissProt Q7ZWG9.1 222 RecName: Full=Sigma non-opioid intracellular receptor 1; AltName: Full=Sigma 1-type opioid receptor; Short=Sigma1-receptor; Short=Sigma1R [Danio rerio]

Related Sequences to LMP011695 proteins

Reference Database Accession Length Protein Name
GI:41055792 RefSeq XP_003444492.1 222 PREDICTED: sigma non-opioid intracellular receptor 1-like [Oreochromis niloticus]
GI:41055792 RefSeq XP_004538431.1 222 PREDICTED: sigma non-opioid intracellular receptor 1-like [Maylandia zebra]
GI:41055792 RefSeq XP_005729270.1 222 PREDICTED: sigma non-opioid intracellular receptor 1-like [Pundamilia nyererei]
GI:41055792 RefSeq XP_005950676.1 222 PREDICTED: sigma non-opioid intracellular receptor 1-like [Haplochromis burtoni]
GI:41055792 RefSeq XP_006627314.1 265 PREDICTED: sigma non-opioid intracellular receptor 1-like [Lepisosteus oculatus]
GI:41055792 RefSeq XP_007260881.1 222 PREDICTED: sigma non-opioid intracellular receptor 1 [Astyanax mexicanus]