Gene/Proteome Database (LMPD)

LMPD ID
LMP011633
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
platelet-derived growth factor alpha a
Gene Symbol
Synonyms
pdgfa; pdgfa-2; zgc:100777
Chromosome
22

Proteins

platelet-derived growth factor alpha a precursor
Refseq ID NP_919407
Protein GI 656214632
UniProt ID Q9DE50
mRNA ID NM_194426
Length 194
RefSeq Status VALIDATED
MRTALIHFLVCCFSLLSAAAEEAPIPRELIERLSNSEIHSISDLQRILEMDFLENEVLEDVKQGHHKEHLYDSRNLKNLHSRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTAANFLIWPPCVEVRRCSGCCNTSNMRCHPSKKHHRNVKVAKVEYVRRRPKLREVQVQLEDHLECVCTSRHHSESRIHTADIR

Gene Information

Entrez Gene ID
Gene Name
platelet-derived growth factor alpha a
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IBA:RefGenome C extracellular space
GO:0016020 IEA:InterPro C membrane
GO:0005161 IBA:RefGenome F platelet-derived growth factor receptor binding
GO:0007596 IBA:RefGenome P blood coagulation
GO:0007275 IEP:ZFIN P multicellular organismal development
GO:0048008 IBA:RefGenome P platelet-derived growth factor receptor signaling pathway
GO:0070374 IBA:RefGenome P positive regulation of ERK1 and ERK2 cascade
GO:0043406 IBA:RefGenome P positive regulation of MAP kinase activity
GO:0051781 IEA:UniProtKB-KW P positive regulation of cell division
GO:0030335 IBA:RefGenome P positive regulation of cell migration
GO:0008284 IBA:RefGenome P positive regulation of cell proliferation
GO:0014068 IBA:RefGenome P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0031954 IBA:RefGenome P positive regulation of protein autophosphorylation

Domain Information

InterPro Annotations

Accession Description
IPR029034 Cystine-knot_cytokine
IPR000072 PDGF/VEGF_dom
IPR006782 PDGF_N

UniProt Annotations

Entry Information

Gene Name
platelet-derived growth factor alpha a
Protein Entry
Q9DE50_DANRE
UniProt ID
Species
Zebrafish

Identical and Related Proteins

Unique RefSeq proteins for LMP011633 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
656214632 RefSeq NP_919407 194 platelet-derived growth factor alpha a precursor

Identical Sequences to LMP011633 proteins

Reference Database Accession Length Protein Name
GI:656214632 RefSeq XP_009294688.1 194 PREDICTED: platelet-derived growth factor subunit A-like [Danio rerio]

Related Sequences to LMP011633 proteins

Reference Database Accession Length Protein Name
GI:656214632 GenBank AAG43478.1 195 platelet-derived growth factor A chain [Danio rerio]
GI:656214632 GenBank AAH78289.1 194 Pdgfaa protein [Danio rerio]
GI:656214632 GenBank AHH38425.1 203 Platelet-derived growth factor subunit A [Ictalurus punctatus]
GI:656214632 GenBank AHH41755.1 203 Platelet-derived growth factor subunit A [Ictalurus punctatus]
GI:656214632 RefSeq XP_007236087.1 202 PREDICTED: platelet-derived growth factor subunit A-like [Astyanax mexicanus]
GI:656214632 RefSeq XP_008282014.1 208 PREDICTED: platelet-derived growth factor subunit A [Stegastes partitus]