Gene/Proteome Database (LMPD)

LMPD ID
LMP011611
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
unc-119 homolog 1
Gene Symbol
Synonyms
unc119b; id:ibd2212; wu:fc47b02; zgc:111863
Alternate Names
protein unc-119 homolog B; Unc119c; protein unc-119 homolog 1
Chromosome
8

Proteins

protein unc-119 homolog B
Refseq ID NP_997952
Protein GI 47086467
UniProt ID Q90Z08
mRNA ID NM_212787
Length 243
RefSeq Status PROVISIONAL
MNSQSSRNETAATAVNGSDSAAASRDRKSGGGVLKRLKSRRNQVDRRPVTEEELRALGRDITPDEVLGLRAVARDYLCKLEDNIYNIDFTRFKIRDLETGTVLFEIAKPPHCDLDEEDDENRDADTSAGRFVRYQFTPAFLKLRTVGATVEFTVGDQPVTNFRMIERHYFQDRLLKSFDFDFGFCIPNSRNTCEHIYEFPQLPEDLIRLMIEHPYETRSDSFYFVDNKLIMHNKADYAYNGGQ

Gene Information

Entrez Gene ID
Gene Name
unc-119 homolog 1
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005929 IEA:UniProtKB-KW C cilium
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0070121 IMP:ZFIN P Kupffer's vesicle development
GO:0060271 IMP:UniProtKB P cilium morphogenesis
GO:0007399 IMP:ZFIN P nervous system development
GO:0015031 IEA:UniProtKB-KW P protein transport

Domain Information

InterPro Annotations

Accession Description
IPR008015 GMP phosphodiesterase, delta subunit
IPR014756 Immunoglobulin E-set

UniProt Annotations

Entry Information

Gene Name
unc-119 homolog 1
Protein Entry
U119B_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Domain Adopts an immunoglobulin-like beta-sandwich fold forming a hydrophobic cavity that capture N-terminally myristoylated target peptides. Phe residues within the hydrophobic beta sandwich are required for myristate binding (By similarity). {ECO:0000250}.
Function Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N- terminally myristoylated proteins and is required for their localization. Plays a key role in localization of proteins to the primary cilium membrane. {ECO:0000269|PubMed:22085962}.
Similarity Belongs to the PDE6D/unc-119 family. {ECO:0000305}.
Subcellular Location Cell projection, cilium {ECO:0000250}.
Tissue Specificity Detected in embryo. Detected in larvae four days after fertilization, in retina and neural tissues (at protein level). Detected in embryos at the sphere stage, during gastrulation, somitogenesis and in swimming larvae, both within and outside of the developing nervous system. Detected in adults. {ECO:0000269|PubMed:15593328}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011611 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
47086467 RefSeq NP_997952 243 protein unc-119 homolog B

Identical Sequences to LMP011611 proteins

Reference Database Accession Length Protein Name
GI:47086467 GenBank AAK70467.1 243 Unc119c [Danio rerio]
GI:47086467 GenBank AAI62277.1 243 Unc-119 homolog 1 [Danio rerio]
GI:47086467 GenBank AAI62287.1 243 Unc-119 homolog 1 [Danio rerio]

Related Sequences to LMP011611 proteins

Reference Database Accession Length Protein Name
GI:47086467 EMBL CDQ65616.1 248 unnamed protein product [Oncorhynchus mykiss]
GI:47086467 EMBL CDQ56317.1 246 unnamed protein product [Oncorhynchus mykiss]
GI:47086467 GenBank AHH38939.1 243 Protein unc-119 B [Ictalurus punctatus]
GI:47086467 RefSeq XP_003445716.1 247 PREDICTED: protein unc-119 homolog B-like [Oreochromis niloticus]
GI:47086467 RefSeq XP_007247198.1 240 PREDICTED: protein unc-119 homolog B [Astyanax mexicanus]
GI:47086467 SwissProt Q90Z08.2 243 RecName: Full=Protein unc-119 homolog B; AltName: Full=Protein unc-119 homolog 1 [Danio rerio]