Gene/Proteome Database (LMPD)
LMPD ID
LMP011602
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Gene Symbol
Synonyms
Ch25h; fa92a08; wu:fa92a08; zgc:110696; si:dkey-24l11.8
Alternate Names
cholesterol 25-hydroxylase-like protein 1, member 1; cholesterol 25-hydroxylase like 1, member 1
Chromosome
18
EC Number
1.14.99.-
Proteins
| cholesterol 25-hydroxylase-like protein 1, member 1 | |
|---|---|
| Refseq ID | NP_001017865 |
| Protein GI | 62955703 |
| UniProt ID | Q567X1 |
| mRNA ID | NM_001017865 |
| Length | 282 |
| RefSeq Status | PROVISIONAL |
| MWNISEVVFQLPTSSASDRLLQPLWDYLLLRHYTLISSPFFPVLLAFSSYIIFSVPFAVLDVLGEKAPLFKYKIQKDRSPTVGMMLRTLWTAVYNHLVFVLPAVLITNMVMPMPPLPTVAPTVWEMFSGGLGALLVFDTQYFLWHMVHHKNPHLYRWVHAIHHDYISPFSWSTQHLSGVELMTVGFWSNIDPILLKCHPLTVWTLTVYSIWMSVEDHIGYDLPFSPGHLVPFGLLGGAMAHDMHHQKPSSNFAPFFSHWDKIFGTAITVKLTQKSEKEKQVA | |
Gene Information
Entrez Gene ID
Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0004497 | IEA:UniProtKB-KW | F | monooxygenase activity |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| dre00120 | Primary bile acid biosynthesis |
| ko00120 | Primary bile acid biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Protein Entry
C25L1_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Function | May catalyze the formation of 25-hydroxycholesterol from cholesterol. {ECO:0000250}. |
| Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011602 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 62955703 | RefSeq | NP_001017865 | 282 | cholesterol 25-hydroxylase-like protein 1, member 1 |
Identical Sequences to LMP011602 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62955703 | GenBank | AAH92984.1 | 282 | Si:dkey-24l11.8 [Danio rerio] |
Related Sequences to LMP011602 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62955703 | RefSeq | XP_005798337.1 | 276 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1-like [Xiphophorus maculatus] |
| GI:62955703 | RefSeq | XP_007235744.1 | 284 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1-like [Astyanax mexicanus] |
| GI:62955703 | RefSeq | XP_007566487.1 | 276 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Poecilia formosa] |
| GI:62955703 | RefSeq | XP_008280331.1 | 277 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Stegastes partitus] |
| GI:62955703 | RefSeq | XP_008410536.1 | 276 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Poecilia reticulata] |
| GI:62955703 | SwissProt | Q567X1.2 | 282 | RecName: Full=Cholesterol 25-hydroxylase-like protein 1, member 1 [Danio rerio] |