Gene/Proteome Database (LMPD)

LMPD ID
LMP011518
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
fatty acid binding protein 10a, liver basic
Gene Symbol
Synonyms
Lfabp; L-FABP; fabp10; Lb-FABP; z-L-BABP; Zf-FABP10; zgc:92741; zgc:103719
Chromosome
16

Proteins

fatty acid-binding protein 10-A, liver basic
Refseq ID NP_694492
Protein GI 23308627
UniProt ID Q9I8L5
mRNA ID NM_152960
Length 126
RefSeq Status PROVISIONAL
MAFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEITTMDGKKLKCIVKLDGGKLVCRTDRFSHIQEIKAGEMVETLTVGGTTMIRKSKKI

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 10a, liver basic
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0005215 IEA:InterPro F transporter activity

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 10a, liver basic
Protein Entry
FA10A_DANRE
UniProt ID
Species
Zebrafish

Identical and Related Proteins

Unique RefSeq proteins for LMP011518 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
23308627 RefSeq NP_694492 126 fatty acid-binding protein 10-A, liver basic

Identical Sequences to LMP011518 proteins

Reference Database Accession Length Protein Name
GI:23308627 GenBank AAF67743.1 126 liver-basic fatty acid binding protein [Danio rerio]
GI:23308627 GenBank AAH76219.1 126 Fatty acid binding protein 10, liver basic [Danio rerio]
GI:23308627 GenBank AAH81518.1 126 Fatty acid binding protein 10, liver basic [Danio rerio]
GI:23308627 GenBank AAI64928.1 126 Fabp10 protein [Danio rerio]
GI:23308627 PDB 2QO4 126 Chain A, Crystal Structure Of Zebrafish Liver Bile Acid-Binding Protein Complexed With Cholic Acid
GI:23308627 SwissProt Q9I8L5.1 126 RecName: Full=Fatty acid-binding protein 10-A, liver basic; Short=Zf-FABP10; Short=Zf-Lb-FABP; AltName: Full=Fatty acid-binding protein, liver; AltName: Full=Liver bile acid-binding protein; Short=L-BABP; Short=z-L-BABP; AltName: Full=Liver-type fatty acid-binding protein; Short=L-FABP; Short=Liver-type FABP [Danio rerio]

Related Sequences to LMP011518 proteins

Reference Database Accession Length Protein Name
GI:23308627 GenBank ABW38784.1 126 liver-type fatty acid-binding protein [Ctenopharyngodon idella]
GI:23308627 GenBank ACA64700.1 126 liver-basic fatty acid binding protein a [Cyprinus carpio]
GI:23308627 GenBank ACA64701.1 126 liver-basic fatty acid binding protein b [Cyprinus carpio]
GI:23308627 PDB 2QO5 129 Chain A, Crystal Structure Of The Cysteine 91 Threonine Mutant Of Zebrafish Liver Bile Acid-Binding Protein Complexed With Cholic Acid
GI:23308627 PDB 2QO6 126 Chain A, Crystal Structure Of The Glycine 55 Arginine Mutant Of Zebrafish Liver Bile Acid-Binding Protein Complexed With Cholic Acid
GI:23308627 RefSeq XP_007234832.1 126 PREDICTED: fatty acid-binding protein, liver-like [Astyanax mexicanus]