Gene/Proteome Database (LMPD)

LMPD ID
LMP011310
Gene ID
832482
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Squalene monooxygenase 6
Gene Symbol
SQE6
Synonyms
K12G2.4; K12G2_4; SQE6; squalene monoxygenase 6
Alternate Names
Squalene monooxygenase 6
Chromosome
5
EC Number
1.14.13.132

Proteins

Squalene monooxygenase 6
Refseq ID NP_197804
Protein GI 15237903
UniProt ID O65402
mRNA ID NM_122321
Length 517
RefSeq Status REVIEWED
MAFTHVCLWTLVAFVLTWTVFYLTNMKKKATDLADTVAEDQKDGAADVIIVGAGVGGSALAYALAKDGRRVHVIERDMREPERMMGEFMQPGGRLMLSKLGLQDCLEDIDAQKATGLAVYKDGKEADAPFPVDNNNFSYEPSARSFHNGRFVQQLRRKAFSLSNVRLEEGTVKSLLEEKGVVKGVTYKNKEGEETTALAPLTVVCDGCYSNLRRSLNDDNNAEIMSYIVGYISKNCRLEEPEKLHLILSKPSFTMVYQISSTDVRCGFEVLPENFPSIANGEMSTFMKNTIVPQVPPKLRKIFLKGIDEGAHIKVVPAKRMTSTLSKKKGVIVLGDAFNMRHPVVASGMMVLLSDILILRRLLQPLSNLGDANKVSEVINSFYDIRKPMSATVNTLGNAFSQVLIGSTDEAKEAMRQGVYDYLCSGGFRTSGMMALLGGMNPRPLSLVYHLCAITLSSIGQLLSPFPSPLRIWHSLKLFGLAMKMLVPNLKAEGVSQMLFPANAAAYHKSYMAATTL

Gene Information

Entrez Gene ID
832482
Gene Name
Squalene monooxygenase 6
Gene Symbol
SQE6
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0050660 IEA:InterPro F flavin adenine dinucleotide binding
GO:0004506 IEA:UniProtKB-EC F squalene monooxygenase activity

KEGG Pathway Links

KEGG Pathway ID Description
ath00909 Sesquiterpenoid and triterpenoid biosynthesis
ath00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254329 Activation of gene expression by SREBF (SREBP)
6254036 Cholesterol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR003042 Aromatic-ring hydroxylase-like
IPR006076 FAD dependent oxidoreductase
IPR013698 Squalene_epoxidase

UniProt Annotations

Entry Information

Gene Name
Squalene monooxygenase 6
Protein Entry
ERG12_ARATH
UniProt ID
O65402
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Squalene + NADPH + O(2) = (3S)-2,3-epoxy-2,3- dihydrosqualene + NADP(+) + H(2)O.
Cofactor Name=FAD; Xref=ChEBI:CHEBI:57692;
Function Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway.
Pathway Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 2/3.
Similarity Belongs to the squalene monooxygenase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Expressed in seedlings, leaves, stems, inflorescences and siliques. {ECO:0000269|PubMed:17426032}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011310 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15237903 RefSeq NP_197804 517 Squalene monooxygenase 6

Identical Sequences to LMP011310 proteins

Reference Database Accession Length Protein Name
GI:15237903 DBBJ BAB08407.1 517 squalene monooxygenase 1,2 (squalene epoxidase 1,2) (se 1,2) [Arabidopsis thaliana]
GI:15237903 GenBank AAW17576.1 517 Sequence 7 from patent US 6822142
GI:15237903 GenBank ACV99099.1 517 Sequence 7 from patent US 7544863
GI:15237903 GenBank AED65462.1 517 Sequence 7 from patent US 7906710
GI:15237903 gnl TAIR 517 Squalene monooxygenase 6 [Arabidopsis thaliana]
GI:15237903 SwissProt O65402.1 517 RecName: Full=Squalene epoxidase 6; Short=AtSQE6; AltName: Full=Squalene monooxygenase 1,2; Short=SE 1,2 [Arabidopsis thaliana]

Related Sequences to LMP011310 proteins

Reference Database Accession Length Protein Name
GI:15237903 GenBank EFH50432.1 516 hypothetical protein ARALYDRAFT_910438 [Arabidopsis lyrata subsp. lyrata]
GI:15237903 GenBank EFH50433.1 518 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:15237903 RefSeq XP_002874173.1 516 hypothetical protein ARALYDRAFT_910438 [Arabidopsis lyrata subsp. lyrata]
GI:15237903 RefSeq XP_002874174.1 518 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:15237903 RefSeq XP_010421231.1 518 PREDICTED: squalene epoxidase 5-like [Camelina sativa]
GI:15237903 RefSeq XP_010454708.1 518 PREDICTED: squalene epoxidase 5-like [Camelina sativa]