Gene/Proteome Database (LMPD)

LMPD ID
LMP011191
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative Delta(7)-sterol-C5(6)-desaturase 2
Gene Symbol
Synonyms
F16B3.22; F16B3_22
Alternate Names
putative Delta(7)-sterol-C5(6)-desaturase 2
Chromosome
3
EC Number
1.14.21.6

Proteins

putative Delta(7)-sterol-C5(6)-desaturase 2
Refseq ID NP_186908
Protein GI 15232937
UniProt ID Q9M883
mRNA ID NM_111127
Length 279
RefSeq Status REVIEWED
MAATMADYNDQIVNETSFYNRMVLSHLLPVNLWEPLPHFLQTWLRNYLAGNILYFISGFLWCFYIYYLKLNVYVPKESIPTRKAMLLQIYVAMKAMPWYTLLPAVSEYMIEHGWTKCYSTLDHFNWFLCFLYIALYLVLVEFMIYWVHKELHDIKFLYKHLHATHHMYNKQNTLSPFAGLAFHPLDGILQAIPHVIALFIVPIHLITHLSLLFLEGIWTASIHDCIHGNIWPIMGAGYHTIHHTTYKHNYGHYTIWMDWMFGSLMVPLAEKDSFKEKEK

Gene Information

Entrez Gene ID
Gene Name
putative Delta(7)-sterol-C5(6)-desaturase 2
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005506 IEA:InterPro F iron ion binding
GO:0050046 IEA:UniProtKB-EC F lathosterol oxidase activity
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0016126 IEA:UniProtKB-KW P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254329 Activation of gene expression by SREBF (SREBP)
6254036 Cholesterol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
putative Delta(7)-sterol-C5(6)-desaturase 2
Protein Entry
SC5D2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity 5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = cholesta-5,7-dien-3-beta-ol + NAD(P)(+) + 2 H(2)O.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011191 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15232937 RefSeq NP_186908 279 putative Delta(7)-sterol-C5(6)-desaturase 2

Identical Sequences to LMP011191 proteins

Reference Database Accession Length Protein Name
GI:15232937 GenBank AAF32466.1 279 putative sterol-C5-desaturase [Arabidopsis thaliana]
GI:15232937 GenBank ABP13195.1 279 Sequence 23 from patent US 7183459
GI:15232937 GenBank AEE73833.1 279 putative Delta(7)-sterol-C5(6)-desaturase 2 [Arabidopsis thaliana]
GI:15232937 GenBank AGD03061.1 279 Sequence 517 from patent US 8343764
GI:15232937 SwissProt Q9M883.1 279 RecName: Full=Putative Delta(7)-sterol-C5(6)-desaturase 2; AltName: Full=Delta(7)-sterol-C5-desaturase 2; AltName: Full=Delta-7-C-5 sterol desaturase 2; AltName: Full=Homolog of DWF7 protein [Arabidopsis thaliana]

Related Sequences to LMP011191 proteins

Reference Database Accession Length Protein Name
GI:15232937 GenBank EFH58500.1 284 hypothetical protein ARALYDRAFT_477496 [Arabidopsis lyrata subsp. lyrata]
GI:15232937 GenBank ESQ49855.1 279 hypothetical protein EUTSA_v10021293mg [Eutrema salsugineum]
GI:15232937 RefSeq XP_002882241.1 284 hypothetical protein ARALYDRAFT_477496 [Arabidopsis lyrata subsp. lyrata]
GI:15232937 RefSeq XP_009134687.1 276 PREDICTED: putative Delta(7)-sterol-C5(6)-desaturase 2 [Brassica rapa]
GI:15232937 RefSeq XP_010463676.1 264 PREDICTED: putative Delta(7)-sterol-C5(6)-desaturase 2 [Camelina sativa]
GI:15232937 RefSeq XP_010485573.1 276 PREDICTED: putative Delta(7)-sterol-C5(6)-desaturase 2 [Camelina sativa]