Gene/Proteome Database (LMPD)

LMPD ID
LMP011145
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
DHHC-type zinc finger family protein
Gene Symbol
Alternate Names
DHHC-type zinc finger family protein
Chromosome
3
EC Number
2.3.1.225

Proteins

DHHC-type zinc finger family protein
Refseq ID NP_188492
Protein GI 22331163
UniProt ID Q9LIH7
mRNA ID NM_112748
Length 345
RefSeq Status REVIEWED
MEDSSQGSFVATINEDYEAICWGCGLNLVLPSYAPVFKCGWCGAITNQNPVRPETKSFGLRRFRDRCFVVILAVFMLFVICGGIWAAYPVLFSISLACGIFHSVTTATLAISTLSTFILVAFKCAGKPTNILYGTHPGVGNGALNNYTFCNYCSKPKSPRTHHCRTCGMCVLDMDHHCPFIGNCVGAGNHKYFIAFLISAVISTSYAAVMCVYTLIHILPPIEKGAAYASDVAHVAHGNSISILRVVKNICLTYIANAVFISVRSLVLVYLFVASVSVAIGLSVLLWQQLSYIYEGKTYLSHLSSQGTEEDGEKSCRNLLTFFGCPHSIERHLPTIRNLRKRHKT

Gene Information

Entrez Gene ID
Gene Name
DHHC-type zinc finger family protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005773 IEA:UniProtKB-KW C vacuole
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding

Domain Information

InterPro Annotations

Accession Description
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
DHHC-type zinc finger family protein
Protein Entry
ZDHC7_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Domain The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}.
Function S-acyltransferase involved in protein lipid modification. {ECO:0000269|PubMed:22968831, ECO:0000269|Ref.4}.
Similarity Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}.
Similarity Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}.
Subcellular Location Vacuole membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011145 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22331163 RefSeq NP_188492 345 DHHC-type zinc finger family protein

Identical Sequences to LMP011145 proteins

Reference Database Accession Length Protein Name
GI:22331163 DBBJ BAB02220.1 345 unnamed protein product [Arabidopsis thaliana]
GI:22331163 GenBank AAL87266.1 345 unknown protein [Arabidopsis thaliana]
GI:22331163 GenBank AAM45051.1 345 unknown protein [Arabidopsis thaliana]
GI:22331163 GenBank AEE76123.1 345 DHHC-type zinc finger family protein [Arabidopsis thaliana]
GI:22331163 SwissProt Q9LIH7.1 345 RecName: Full=Protein S-acyltransferase 11; AltName: Full=Probable palmitoyltransferase At3g18620; AltName: Full=Zinc finger DHHC domain-containing protein At3g18620 [Arabidopsis thaliana]

Related Sequences to LMP011145 proteins

Reference Database Accession Length Protein Name
GI:22331163 GenBank EFH59401.1 345 zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
GI:22331163 GenBank EOA30953.1 345 hypothetical protein CARUB_v10014099mg [Capsella rubella]
GI:22331163 RefSeq XP_002883142.1 345 zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
GI:22331163 RefSeq XP_006298055.1 345 hypothetical protein CARUB_v10014099mg [Capsella rubella]
GI:22331163 RefSeq XP_010507042.1 345 PREDICTED: protein S-acyltransferase 11 [Camelina sativa]
GI:22331163 RefSeq XP_010465971.1 370 PREDICTED: protein S-acyltransferase 11-like [Camelina sativa]