Gene/Proteome Database (LMPD)

LMPD ID
LMP011128
Gene ID
832645
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
protein peroxin4
Gene Symbol
PEX4
Synonyms
F18A17.10; F18A17_10; peroxin4; PEX4; UBC21; ubiquitin-conjugating enzyme 21
Alternate Names
protein peroxin4
Chromosome
5
EC Number
6.3.2.19

Proteins

protein peroxin4
Refseq ID NP_001031939
Protein GI 79328676
UniProt ID Q8LGF7
mRNA ID NM_001036862
Length 157
RefSeq Status REVIEWED
MQASRARLFKEYKEVQREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDVRGFNSMAQMYTRLAAMPKKG
protein peroxin4
Refseq ID NP_568476
Protein GI 18420949
UniProt ID Q8LGF7
mRNA ID NM_122477
Length 157
RefSeq Status REVIEWED
Protein sequence is identical to GI:79328676 (mRNA isoform)

Gene Information

Entrez Gene ID
832645
Gene Name
protein peroxin4
Gene Symbol
PEX4
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0005777 IEA:UniProtKB-KW C peroxisome
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0016881 IEA:InterPro F acid-amino acid ligase activity
GO:0004842 ISS:TAIR F ubiquitin-protein transferase activity
GO:0006635 IMP:TAIR P fatty acid beta-oxidation
GO:0007031 IMP:TAIR P peroxisome organization
GO:0016558 IMP:TAIR P protein import into peroxisome matrix

Domain Information

InterPro Annotations

Accession Description
IPR000608 Ubiquitin-conjugating enzyme E2
IPR023313 Ubiquitin-conjugating enzyme, active site
IPR016135 Ubiquitin-conjugating enzyme/RWD-like

UniProt Annotations

Entry Information

Gene Name
protein peroxin4
Protein Entry
PEX4_ARATH
UniProt ID
Q8LGF7
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine. {ECO:0000255|PROSITE- ProRule:PRU00388, ECO:0000255|PROSITE-ProRule:PRU10133}.
Function Required for peroxisome biogenesis. Necessary for the developmental elimination of obsolete peroxisome matrix proteins. May be involved in the ubiquitination of PEX5, targeting it for recycling. Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins (By similarity). {ECO:0000250}.
Pathway Protein modification; protein ubiquitination. {ECO:0000255|PROSITE-ProRule:PRU00388}.
Similarity Belongs to the ubiquitin-conjugating enzyme family. {ECO:0000255|PROSITE-ProRule:PRU00388}.
Subcellular Location Peroxisome membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}.
Subunit Interacts with PEX22. {ECO:0000269|PubMed:16272432}.
Web Resource Name=PlantsUBQ; Note=A functional genomics database for the ubiquitin/26S proteasome proteolytic pathway in plants; URL="http://plantsubq.genomics.purdue.edu/";

Identical and Related Proteins

Unique RefSeq proteins for LMP011128 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
79328676 RefSeq NP_001031939 157 protein peroxin4

Identical Sequences to LMP011128 proteins

Reference Database Accession Length Protein Name
GI:79328676 GenBank AAM60888.1 157 E2, ubiquitin-conjugating enzyme, putative [Arabidopsis thaliana]
GI:79328676 GenBank AAY44861.1 157 ubiquitinating enzyme [Arabidopsis thaliana]
GI:79328676 GenBank ABF59034.1 157 At5g25760 [Arabidopsis thaliana]
GI:79328676 gnl TAIR 157 protein peroxin4 [Arabidopsis thaliana]
GI:79328676 gnl TAIR 157 protein peroxin4 [Arabidopsis thaliana]
GI:79328676 SwissProt Q8LGF7.1 157 RecName: Full=Protein PEROXIN-4; Short=AtPEX4; AltName: Full=Probable ubiquitin-conjugating enzyme E2 21; AltName: Full=Ubiquitin carrier protein 21 [Arabidopsis thaliana]

Related Sequences to LMP011128 proteins

Reference Database Accession Length Protein Name
GI:79328676 GenBank EFH48440.1 157 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:79328676 GenBank EFH62159.1 157 hypothetical protein ARALYDRAFT_899617 [Arabidopsis lyrata subsp. lyrata]
GI:79328676 GenBank ESQ32111.1 157 hypothetical protein EUTSA_v10005728mg [Eutrema salsugineum]
GI:79328676 RefSeq XP_002872181.1 157 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:79328676 RefSeq XP_002885900.1 157 hypothetical protein ARALYDRAFT_899617 [Arabidopsis lyrata subsp. lyrata]
GI:79328676 RefSeq XP_006394825.1 157 hypothetical protein EUTSA_v10005728mg [Eutrema salsugineum]