Gene/Proteome Database (LMPD)

LMPD ID
LMP011094
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
protein ECERIFERUM 3
Gene Symbol
Synonyms
ECERIFERUM 3; FACELESS POLLEN 1; FLP1; MTI20.3; MTI20_3; WAX2; YRE
Alternate Names
protein ECERIFERUM 3
Chromosome
5

Proteins

protein ECERIFERUM 3
Refseq ID NP_200588
Protein GI 30696940
UniProt ID Q8H1Z0
mRNA ID NM_125164
Length 632
RefSeq Status REVIEWED
MVAFLSAWPWENFGNLKYLLYAPLAAQVVYSWVYEEDISKVLWCIHILIICGLKALVHELWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLMMMINSLPLWNTKGLIALIVLHVTFSEPLYYFLHRSFHRNNYFFTHYHSFHHSSPVPHPMTAGNATLLENIILCVVAGVPLIGCCLFGVGSLSAIYGYAVMFDFMRCLGHCNVEIFSHKLFEILPVLRYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLGDTQNPNSWELQKKIRLSAGERKRVPEFVFLAHGVDVMSAMHAPFVFRSFASMPYTTRIFLLPMWPFTFCVMLGMWAWSKTFLFSFYTLRNNLCQTWGVPRFGFQYFLPFATKGINDQIEAAILRADKIGVKVISLAALNKNEALNGGGTLFVNKHPDLRVRVVHGNTLTAAVILYEIPKDVNEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLVWEAAMKYGLSAVSSLTN

Gene Information

Entrez Gene ID
Gene Name
protein ECERIFERUM 3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 ISS:TAIR C membrane
GO:0005886 IDA:TAIR C plasma membrane
GO:0005506 IEA:InterPro F iron ion binding
GO:0016491 IEA:InterPro F oxidoreductase activity
GO:0043447 IDA:TAIR P alkane biosynthetic process
GO:0042335 IMP:TAIR P cuticle development
GO:0006723 IMP:TAIR P cuticle hydrocarbon biosynthetic process
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0048235 IMP:TAIR P pollen sperm cell differentiation
GO:0010025 IMP:TAIR P wax biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase
IPR016040 NAD(P)-binding domain
IPR021940 Uncharacterised domain Wax2, C-terminal

UniProt Annotations

Entry Information

Gene Name
protein ECERIFERUM 3
Protein Entry
CER3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype Plants show postgenital fusion between aerial organs and severe male sterility in low-humidity environments. Altered cuticular waxes, but no effect on cutin load and composition. {ECO:0000269|PubMed:12724542, ECO:0000269|PubMed:12974811, ECO:0000269|PubMed:14756310, ECO:0000269|PubMed:17624331}.
Function Involved in cuticule membrane and wax production, and in the typhine and sopropollenin biosynthesis of pollen. Core components of a very-long-chain alkane synthesis complex. May be the fatty acid reductase responsible for aldehyde formation. {ECO:0000269|PubMed:12724542, ECO:0000269|PubMed:12974811, ECO:0000269|PubMed:14756310, ECO:0000269|PubMed:22773744}.
Sequence Caution Sequence=AAK68765.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=BAB08850.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:16618929, ECO:0000269|PubMed:19892830}; Multi- pass membrane protein {ECO:0000269|PubMed:16618929, ECO:0000269|PubMed:19892830}. Note=PubMed:16618929 indicates a vacuole membrane localization.
Subunit Interacts with CER1. {ECO:0000269|PubMed:22773744}.
Tissue Specificity Expressed in siliques, stems, flowers and weakly in leaves. Not detected in pollen, seeds and roots, but expressed in lateral root primordia. Specifically found in the L1 layer of the shoot apical meristem and in developing trichomes. {ECO:0000269|PubMed:12724542, ECO:0000269|PubMed:12974811, ECO:0000269|PubMed:14756310, ECO:0000269|PubMed:21386033}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011094 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30696940 RefSeq NP_200588 632 protein ECERIFERUM 3

Identical Sequences to LMP011094 proteins

Reference Database Accession Length Protein Name
GI:30696940 DBBJ BAC81644.1 632 YORE-YORE protein [Arabidopsis thaliana]
GI:30696940 DBBJ BAD06945.1 632 faceless pollen-1 [Arabidopsis thaliana]
GI:30696940 GenBank ACX21508.1 632 Sequence 50417 from patent US 7569389
GI:30696940 GenBank ADT60001.1 632 Sequence 892 from patent US 7847156
GI:30696940 gnl TAIR 632 protein ECERIFERUM 3 [Arabidopsis thaliana]
GI:30696940 SwissProt Q8H1Z0.1 632 RecName: Full=Protein ECERIFERUM 3; AltName: Full=Protein FACELESS POLLEN 1; AltName: Full=Protein WAX2; AltName: Full=Protein YORE-YORE [Arabidopsis thaliana]

Related Sequences to LMP011094 proteins

Reference Database Accession Length Protein Name
GI:30696940 GenBank EFH40787.1 632 hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. lyrata]
GI:30696940 GenBank EOA12492.1 629 hypothetical protein CARUB_v10026077mg [Capsella rubella]
GI:30696940 GenBank AIE57504.1 632 CER3 [Camelina sativa]
GI:30696940 RefSeq XP_002864528.1 632 hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. lyrata]
GI:30696940 RefSeq XP_006279594.1 629 hypothetical protein CARUB_v10026077mg [Capsella rubella]
GI:30696940 RefSeq XP_010483318.1 632 PREDICTED: protein ECERIFERUM 3 [Camelina sativa]