Gene/Proteome Database (LMPD)

LMPD ID
LMP011053
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
major facilitator protein
Gene Symbol
Alternate Names
major facilitator protein
Chromosome
5

Proteins

major facilitator protein
Refseq ID NP_680469
Protein GI 22328088
UniProt ID Q6NMN6
mRNA ID NM_148164
Length 492
RefSeq Status REVIEWED
MTRVGQRDSPAKEEAPPATKKRFLTPGRFVTILCIINLINYVDRGVIASNGVNGSSKVCDAKGVCSAGTGIQGEFNLTNFEDGLLSSAFMVGLLVASPIFAGLSKRFNPFKLIGVGLTVWTIAVIGCGFSYNFWMIAVFRMFVGVGEASFISLAAPYIDDSAPVARKNFWLGLFYMCIPAGVALGYVFGGYIGNHLGWRWAFYIEAIAMAVFVILSFCIKPPQQLKGFADKDSKKPSTSIETVAPTDAEASQIKTKTPKSKNLVVLFGKDLKALFSEKVFIVNVLGYITYNFVIGAYSYWGPKAGFGIYKMKNADMIFGGLTIICGIIGTLGGSYVLDRINATLSNTFKLLAASTLLGAAFCFTAFLMKNMYAFIALFAVGEILIFAPQAPVNFVCLHCVRPNLRPLSMASSTVLIHILGDVPSSPLYGKMQDHLKNWRKSTLIITSILFLAAIIWGIGIFMNSVDRSNEVSEDDEVEEDKLESKTENSTLA

Gene Information

Entrez Gene ID
Gene Name
major facilitator protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005768 IEA:UniProtKB-KW C endosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005764 IEA:UniProtKB-KW C lysosome
GO:0005886 IDA:TAIR C plasma membrane
GO:0006869 IEA:UniProtKB-KW P lipid transport
GO:0055085 IEA:InterPro P transmembrane transport

Domain Information

InterPro Annotations

Accession Description
IPR011701 Major facilitator superfamily
IPR020846 Major facilitator superfamily domain

UniProt Annotations

Entry Information

Gene Name
major facilitator protein
Protein Entry
SPNS1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage. {ECO:0000250}.
Sequence Caution Sequence=BAB10676.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAA16689.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the major facilitator superfamily. Spinster (TC 2.A.1.49) family. {ECO:0000305}.
Subcellular Location Late endosome membrane {ECO:0000250}; Multi- pass membrane protein {ECO:0000250}. Lysosome membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011053 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22328088 RefSeq NP_680469 492 major facilitator protein

Identical Sequences to LMP011053 proteins

Reference Database Accession Length Protein Name
GI:22328088 GenBank AAS47627.1 492 At5g65687 [Arabidopsis thaliana]
GI:22328088 GenBank AAT41792.1 492 At5g65687 [Arabidopsis thaliana]
GI:22328088 gnl TAIR 492 major facilitator protein [Arabidopsis thaliana]
GI:22328088 SwissProt Q6NMN6.1 492 RecName: Full=Probable sphingolipid transporter spinster homolog 1 [Arabidopsis thaliana]

Related Sequences to LMP011053 proteins

Reference Database Accession Length Protein Name
GI:22328088 DBBJ BAB10676.1 746 unnamed protein product [Arabidopsis thaliana]
GI:22328088 EMBL CAA16689.1 746 predicted protein [Arabidopsis thaliana]
GI:22328088 GenBank EFH42944.1 914 hypothetical protein ARALYDRAFT_358769 [Arabidopsis lyrata subsp. lyrata]
GI:22328088 RefSeq XP_002866685.1 914 hypothetical protein ARALYDRAFT_358769 [Arabidopsis lyrata subsp. lyrata]
GI:22328088 RefSeq XP_010444580.1 502 PREDICTED: probable sphingolipid transporter spinster homolog 1 [Camelina sativa]
GI:22328088 RefSeq XP_010484406.1 504 PREDICTED: probable sphingolipid transporter spinster homolog 1 isoform X1 [Camelina sativa]