Gene/Proteome Database (LMPD)

LMPD ID
LMP011037
Gene ID
2745525
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Ankyrin repeat family protein with DHHC zinc finger domain
Gene Symbol
AT2G14255
Alternate Names
Ankyrin repeat family protein with DHHC zinc finger domain
Chromosome
2
EC Number
2.3.1.225

Proteins

Ankyrin repeat family protein with DHHC zinc finger domain
Refseq ID NP_973453
Protein GI 186500357
UniProt ID Q3EC11
mRNA ID NM_201724
Length 536
RefSeq Status REVIEWED
MDSSEIEVVPLDSNSHQSPTESPTITDVFSASAYGDLHQLKHFVEHNGSSVSLPDDNGFYALQWAALNNSLHVAQYIIQHGGDVNSADNIQQTPLHWAAVKGSIDVADLLLQHGARIEAVDVNGFRAVHVASQYGQTAFVNHIIVDYAADYNALDIEGRSPLHWAAYNGFTETVRLLLFRDACQNRQDNTGCTPLHWAVIKENVEACTLLVHAGTKEELILKDNTGSTPLKLASDKGHRQLALFLSKAMRTRKNSFVDKIFCGKLGETSYAPMLFSLIVILMVLFITSIVSASNLPKITAMVGLWACFGLSCGVYALITFYRVSRKDPGYVKRTGEANSQHTANDPLIDINFKNPSWKGNWSQLCPTCKIIRPVRSKHCPTCKRCVEQFDHHCPWISNCVGKKNKRYFLVFVIMGALTSFVGGTTAVQRLWRGIPQVHHGESWIKHIVIEHPDAAVFLFFDLLIFIATMTLTISQSYMIARNITTNELWNAKRFSYLRGPDGRFYNPYNHGLRRNCTDFLVHGYTRDDEVVPSSIL

Gene Information

Entrez Gene ID
2745525
Gene Name
Ankyrin repeat family protein with DHHC zinc finger domain
Gene Symbol
AT2G14255
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:TAIR C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding

Domain Information

InterPro Annotations

Accession Description
IPR002110 Ankyrin repeat
IPR020683 Ankyrin repeat-containing domain
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
Ankyrin repeat family protein with DHHC zinc finger domain
Protein Entry
ZDHC2_ARATH
UniProt ID
Q3EC11
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced.; Name=1; IsoId=Q3EC11-1; Sequence=Displayed;
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Domain The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}.
Function Palmitoyl acyltransferase. {ECO:0000250}.
Sequence Caution Sequence=AAD20110.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}.
Similarity Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}.
Similarity Contains 6 ANK repeats. {ECO:0000255|PROSITE- ProRule:PRU00023}.
Subcellular Location Golgi apparatus membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Expressed in roots, shoots, flowers and pollen. {ECO:0000269|PubMed:22968831}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011037 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
186500357 RefSeq NP_973453 536 Ankyrin repeat family protein with DHHC zinc finger domain

Identical Sequences to LMP011037 proteins

Reference Database Accession Length Protein Name
GI:186500357 GenBank AEC06292.1 536 Ankyrin repeat family protein with DHHC zinc finger domain [Arabidopsis thaliana]
GI:186500357 SwissProt Q3EC11.2 536 RecName: Full=Probable protein S-acyltransferase 23; AltName: Full=Probable palmitoyltransferase At2g14255; AltName: Full=Zinc finger DHHC domain-containing protein At2g14255 [Arabidopsis thaliana]

Related Sequences to LMP011037 proteins

Reference Database Accession Length Protein Name
GI:186500357 GenBank ESQ51112.1 536 hypothetical protein EUTSA_v10022988mg [Eutrema salsugineum]
GI:186500357 RefSeq XP_006409659.1 536 hypothetical protein EUTSA_v10022988mg [Eutrema salsugineum]
GI:186500357 RefSeq XP_010517459.1 549 PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Camelina sativa]
GI:186500357 RefSeq XP_010517465.1 536 PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Camelina sativa]
GI:186500357 RefSeq XP_010467225.1 536 PREDICTED: probable protein S-acyltransferase 23 [Camelina sativa]
GI:186500357 RefSeq XP_010488875.1 536 PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Camelina sativa]