Gene/Proteome Database (LMPD)
Proteins
| putative S-acyltransferase | |
|---|---|
| Refseq ID | NP_567193 |
| Protein GI | 79458493 |
| UniProt ID | Q5M757 |
| mRNA ID | NM_116310 |
| Length | 291 |
| RefSeq Status | REVIEWED |
| MNLFRFCSGLKVLGYFMILLVVAVVGVSYYAVVVSTWWPILIRGDHGALSALAALIIFVFHFLLIMLLWSYFTTVFTDPGSVPEHFRREMGGGDSLEAGTSTDQGAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHISLLSSNTTSVEVHEKNGEVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDIDNITSLEGLEFPTCSDIDP | |
Gene Information
Entrez Gene ID
Gene Name
putative S-acyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
putative S-acyltransferase
Protein Entry
ZDH15_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}. |
| Function | Palmitoyl acyltransferase. {ECO:0000250}. |
| Sequence Caution | Sequence=AAB62854.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB80893.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}. |
| Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
| Subcellular Location | Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011028 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 79458493 | RefSeq | NP_567193 | 291 | putative S-acyltransferase |
Identical Sequences to LMP011028 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:79458493 | DBBJ | BAF01156.1 | 291 | hypothetical protein [Arabidopsis thaliana] |
| GI:79458493 | GenBank | AAV91337.1 | 291 | At4g00840 [Arabidopsis thaliana] |
| GI:79458493 | GenBank | AAW39012.1 | 291 | At4g00840 [Arabidopsis thaliana] |
| GI:79458493 | GenBank | AEE81944.1 | 291 | putative S-acyltransferase [Arabidopsis thaliana] |
| GI:79458493 | SwissProt | Q5M757.1 | 291 | RecName: Full=Probable protein S-acyltransferase 12; AltName: Full=Probable palmitoyltransferase At4g00840; AltName: Full=Zinc finger DHHC domain-containing protein At4g00840 [Arabidopsis thaliana] |
Related Sequences to LMP011028 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:79458493 | GenBank | EFH49185.1 | 291 | zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] |
| GI:79458493 | GenBank | EOA21264.1 | 291 | hypothetical protein CARUB_v10001614mg [Capsella rubella] |
| GI:79458493 | RefSeq | XP_002872926.1 | 291 | zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] |
| GI:79458493 | RefSeq | XP_006288366.1 | 291 | hypothetical protein CARUB_v10001614mg [Capsella rubella] |
| GI:79458493 | RefSeq | XP_010422733.1 | 291 | PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa] |
| GI:79458493 | RefSeq | XP_010456165.1 | 291 | PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa] |