Gene/Proteome Database (LMPD)

LMPD ID
LMP011011
Gene ID
843405
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Caleosin-related family protein
Gene Symbol
AT1G70680
Synonyms
F5A18.14; F5A18_14
Alternate Names
Caleosin-related family protein
Chromosome
1
EC Number
1.11.2.3

Proteins

Caleosin-related family protein
Refseq ID NP_564996
Protein GI 18409651
UniProt ID Q9CAB8
mRNA ID NM_105736
Length 192
RefSeq Status REVIEWED
MASSISAAEVKVVPEEYNFLQKHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSTFAAVFINISLSSKTRPGKGFSFSFPIEVKNVRLGIHSSDSGVYDKDGRFVASKFEEIFAKHAHTHRDALTSKELKELLKANREPNDCKGGILAFGEWKVLYNLCKDKSGLLHKEIVRAVYDGSLFEQLEKQRSSKTP

Gene Information

Entrez Gene ID
843405
Gene Name
Caleosin-related family protein
Gene Symbol
AT1G70680
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0005811 IEA:UniProtKB-KW C lipid particle
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:1990137 IEA:UniProtKB-EC F plant seed peroxidase activity

Domain Information

InterPro Annotations

Accession Description
IPR007736 Caleosin

UniProt Annotations

Entry Information

Gene Name
Caleosin-related family protein
Protein Entry
PXG5_ARATH
UniProt ID
Q9CAB8
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity RH + ROOH = ROH + ROH.
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250};
Cofactor Name=heme b; Xref=ChEBI:CHEBI:60344; Evidence={ECO:0000250}; Note=Binds 1 heme b (iron(II)-protoporphyrin IX) group. {ECO:0000250};
Domain The proline-knot motif (71-80) may be involved in targeting to lipid bodies.
Domain Transmembrane regions are predicted by sequence analysis tools, but these regions probably constitute hydrophobic domains associated to phospholipids.
Function Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination (By similarity). {ECO:0000250}.
Induction Not regulated by abscisic acid, desiccation and osmotic stress. {ECO:0000269|PubMed:11197322, ECO:0000269|PubMed:19467604}.
Similarity Belongs to the caleosin family. {ECO:0000305}.
Similarity Contains 1 EF-hand domain. {ECO:0000305}.
Subcellular Location Lipid droplet. Microsome membrane {ECO:0000250}.
Subunit Homodimer. {ECO:0000250}.
Tissue Specificity Expressed in roots, leaves, shoots and flowers. {ECO:0000269|PubMed:11197322, ECO:0000269|PubMed:19467604}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011011 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18409651 RefSeq NP_564996 192 Caleosin-related family protein

Identical Sequences to LMP011011 proteins

Reference Database Accession Length Protein Name
GI:18409651 EMBL CAW44115.1 192 unnamed protein product [Arabidopsis thaliana]
GI:18409651 EMBL CBC01363.1 192 unnamed protein product [Arabidopsis thaliana]
GI:18409651 EMBL CBC09624.1 192 unnamed protein product [Arabidopsis thaliana]
GI:18409651 GenBank ACW87772.1 192 Sequence 4595 from patent US 7569389
GI:18409651 GenBank ACW88994.1 192 Sequence 6256 from patent US 7569389
GI:18409651 GenBank AEE35099.1 192 Caleosin-related family protein [Arabidopsis thaliana]

Related Sequences to LMP011011 proteins

Reference Database Accession Length Protein Name
GI:18409651 DBBJ BAF00552.1 192 hypothetical protein [Arabidopsis thaliana]
GI:18409651 EMBL CAW35353.1 192 unnamed protein product [Arabidopsis thaliana]
GI:18409651 EMBL CAW44142.1 192 unnamed protein product [Arabidopsis thaliana]
GI:18409651 EMBL CBC01387.1 192 unnamed protein product [Arabidopsis thaliana]
GI:18409651 EMBL CBC09648.1 192 unnamed protein product [Arabidopsis thaliana]
GI:18409651 GenBank AAM67011.1 192 unknown [Arabidopsis thaliana]