Gene/Proteome Database (LMPD)
Proteins
| putative long-chain-alcohol O-fatty-acyltransferase 5 | |
|---|---|
| Refseq ID | NP_200345 |
| Protein GI | 15240496 |
| UniProt ID | Q9FJ76 |
| mRNA ID | NM_124916 |
| Length | 333 |
| RefSeq Status | REVIEWED |
| MDEELKNLIKVWVSAIISISYCYYIPPRIKSGAPRFLSVSPVLALFLVLPLFFSSLHLSLITAFFLTWLANFKLILFSFDKGPLIPIPTNFPRFFCFTCFPIKVQQNPKSQNHLPKLVFAIKLAIFAVLLHLYSYRQNLSPTILLGLYFVHLYLEIEIILTFVKVVVFISLGCDLEPQSNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERKMSSGWALFPGILAAFIVSGLVHELLFFYLIREMPTGEVTLFFVLHGVCTAVELAVKKKTTVAQRWRLSPGVSRVLTVGFVFVTGGWLFTPQLKRSGVMERFTSEAVLLVEFIKR | |
Gene Information
Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 5
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0047196 | IEA:UniProtKB-EC | F | long-chain-alcohol O-fatty-acyltransferase activity |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR017088 | Wax synthase |
UniProt Annotations
Entry Information
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 5
Protein Entry
WAXS5_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester. |
| Function | Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}. |
| Similarity | Belongs to the wax synthase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011000 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15240496 | RefSeq | NP_200345 | 333 | putative long-chain-alcohol O-fatty-acyltransferase 5 |
Identical Sequences to LMP011000 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15240496 | DBBJ | BAB08551.1 | 333 | unnamed protein product [Arabidopsis thaliana] |
| GI:15240496 | GenBank | AAM61298.1 | 333 | wax synthase-like protein [Arabidopsis thaliana] |
| GI:15240496 | GenBank | ACC06872.1 | 333 | Sequence 12 from patent US 7332311 |
| GI:15240496 | GenBank | ACW87603.1 | 333 | Sequence 4364 from patent US 7569389 |
| GI:15240496 | gnl | TAIR | 333 | putative long-chain-alcohol O-fatty-acyltransferase 5 [Arabidopsis thaliana] |
| GI:15240496 | SwissProt | Q9FJ76.1 | 333 | RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 5; AltName: Full=Wax synthase 5 [Arabidopsis thaliana] |
Related Sequences to LMP011000 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15240496 | GenBank | EFH42350.1 | 335 | long-chain-alcohol O-fatty-acyltransferase family protein, partial [Arabidopsis lyrata subsp. lyrata] |
| GI:15240496 | GenBank | EOA14627.1 | 334 | hypothetical protein CARUB_v10027886mg [Capsella rubella] |
| GI:15240496 | RefSeq | XP_002866091.1 | 335 | long-chain-alcohol O-fatty-acyltransferase family protein, partial [Arabidopsis lyrata subsp. lyrata] |
| GI:15240496 | RefSeq | XP_006281729.1 | 334 | hypothetical protein CARUB_v10027886mg [Capsella rubella] |
| GI:15240496 | RefSeq | XP_010449487.1 | 348 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 5 [Camelina sativa] |
| GI:15240496 | RefSeq | XP_010443156.1 | 348 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 5 [Camelina sativa] |