Gene/Proteome Database (LMPD)
Proteins
| phytanoyl-CoA 2-hydroxylase | |
|---|---|
| Refseq ID | NP_565262 |
| Protein GI | 18379234 |
| UniProt ID | Q9ZVF6 |
| mRNA ID | NM_126210 |
| Length | 283 |
| RefSeq Status | REVIEWED |
| MGITGSLTPDQLDFFHSQGYLVIESFASEDEIRGLRKRMDELLNQFDCSVSSIFSTKNQKHTTDNYFFESAEKISFFFEEKAFGDDGKLKQPKQLSINKVGHALHELDPLYKDFTYSSKFSSLASSLGYRRPVVMQSMYIFKQPGIGGEVVPHQDNSFVYTDPQSCTGLWIALEDSTLVNGCLWAIPGSHKNGLVRRFIRGDNGITFDQPSPSYEQKDFVSIEMKAGSLIAIHGDLIHQSFENLSSKSRHAYSLHVVESDGCKWAKDNWIQRAKMPEPLYVLP | |
Gene Information
Entrez Gene ID
Gene Name
phytanoyl-CoA 2-hydroxylase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005886 | IDA:TAIR | C | plasma membrane |
| GO:0031418 | IEA:UniProtKB-KW | F | L-ascorbic acid binding |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0048244 | IMP:TAIR | F | phytanoyl-CoA dioxygenase activity |
| GO:0006631 | IEA:UniProtKB-UniPathway | P | fatty acid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008775 | Phytanoyl-CoA dioxygenase |
UniProt Annotations
Entry Information
Gene Name
phytanoyl-CoA 2-hydroxylase
Protein Entry
PAHX_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phytanoyl-CoA + 2-oxoglutarate + O(2) = 2- hydroxyphytanoyl-CoA + succinate + CO(2). |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Cofactor | Name=L-ascorbate; Xref=ChEBI:CHEBI:38290; Evidence={ECO:0000250}; |
| Disruption Phenotype | No visible phenotypes under normal growth conditions. {ECO:0000269|PubMed:21788362}. |
| Function | Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. {ECO:0000269|PubMed:21788362}. |
| Pathway | Lipid metabolism; fatty acid metabolism. |
| Similarity | Belongs to the PhyH family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010910 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18379234 | RefSeq | NP_565262 | 283 | phytanoyl-CoA 2-hydroxylase |
Identical Sequences to LMP010910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18379234 | GenBank | AAL15340.1 | 283 | At2g01490/F2I9.11 [Arabidopsis thaliana] |
| GI:18379234 | GenBank | AAM51599.1 | 283 | At2g01490/F2I9.11 [Arabidopsis thaliana] |
| GI:18379234 | GenBank | AEC05460.1 | 283 | phytanoyl-CoA 2-hydroxylase [Arabidopsis thaliana] |
| GI:18379234 | gnl | TIGR | 283 | expressed protein [Arabidopsis thaliana] |
| GI:18379234 | SwissProt | Q9ZVF6.2 | 283 | RecName: Full=Phytanoyl-CoA dioxygenase; AltName: Full=Phytanoyl-CoA 2-hydroxylase [Arabidopsis thaliana] |
Related Sequences to LMP010910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18379234 | GenBank | AAM65626.1 | 283 | unknown [Arabidopsis thaliana] |
| GI:18379234 | GenBank | EFH51334.1 | 284 | hypothetical protein ARALYDRAFT_484067 [Arabidopsis lyrata subsp. lyrata] |
| GI:18379234 | GenBank | EOA24436.1 | 309 | hypothetical protein CARUB_v10017693mg, partial [Capsella rubella] |
| GI:18379234 | RefSeq | XP_002875075.1 | 284 | hypothetical protein ARALYDRAFT_484067 [Arabidopsis lyrata subsp. lyrata] |
| GI:18379234 | RefSeq | XP_010424920.1 | 283 | PREDICTED: phytanoyl-CoA dioxygenase isoform X1 [Camelina sativa] |
| GI:18379234 | RefSeq | XP_010424921.1 | 283 | PREDICTED: phytanoyl-CoA dioxygenase isoform X2 [Camelina sativa] |