Gene/Proteome Database (LMPD)

LMPD ID
LMP010902
Gene ID
841281
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphoethanolamine N-methyltransferase 2
Gene Symbol
PMEAMT
Synonyms
AtPMEAMT; phosphoethanolamine N-methyltransferase; PMEAMT; T1N15.23; T1N15_23
Alternate Names
phosphoethanolamine N-methyltransferase 2
Chromosome
1
EC Number
2.1.1.-
Summary
Encodes a phosphoethanolamine N-methyltransferase that catalyses the last two methylation steps of the three sequential methylations of phosphoethanolamine (PEA) that are required for the synthesis of phosphocholine (PCho) in plants.
Orthologs
View orthologs and multiple alignments for PMEAMT

Proteins

phosphoethanolamine N-methyltransferase 2
Refseq ID NP_973993
Protein GI 42571805
UniProt ID Q944H0
mRNA ID NM_202264
Length 491
RefSeq Status REVIEWED
MATPYKEERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKEVELMAERMIGWVKPGGYIFFRESCFHQSGDSKRKSNPTHYREPRFYTKVFQECQTRDASGNSFELSMVGCKCIGAYVKNKKNQNQICWIWQKVSVENDKDFQRFLDNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWSAKLERTASGEQKWGLFIADKK
phosphoethanolamine N-methyltransferase 2
Refseq ID NP_175293
Protein GI 15221909
UniProt ID Q944H0
mRNA ID NM_103756
Length 475
RefSeq Status REVIEWED
MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKEVELMAERMIGWVKPGGYIFFRESCFHQSGDSKRKSNPTHYREPRFYTKVFQECQTRDASGNSFELSMVGCKCIGAYVKNKKNQNQICWIWQKVSVENDKDFQRFLDNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWSAKLERTASGEQKWGLFIADKK

Gene Information

Entrez Gene ID
841281
Gene Name
phosphoethanolamine N-methyltransferase 2
Gene Symbol
PMEAMT
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0000234 IEA:InterPro F phosphoethanolamine N-methyltransferase activity
GO:0006656 IEA:UniProtKB-UniPathway P phosphatidylcholine biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00564 Glycerophospholipid metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY4FS-3 phosphatidylcholine biosynthesis III
PWY4FS-4 phosphatidylcholine biosynthesis IV
PWY4FS-5 superpathway of phosphatidylcholine biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR025714 Methyltransferase domain
IPR025771 Phosphoethanolamine N-methyltransferase
IPR029063 S-adenosyl-L-methionine-dependent methyltransferase

UniProt Annotations

Entry Information

Gene Name
phosphoethanolamine N-methyltransferase 2
Protein Entry
PEAM2_ARATH
UniProt ID
Q944H0
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q944H0-1; Sequence=Displayed; Name=2; IsoId=Q944H0-2; Sequence=VSP_053713;
Catalytic Activity S-adenosyl-L-methionine + ethanolamine phosphate = S-adenosyl-L-homocysteine + N-methylethanolamine phosphate. {ECO:0000255|PROSITE-ProRule:PRU00915}.
Disruption Phenotype No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:20650897}.
Function Catalyzes N-methylation of phosphomonomethylethanolamine and phosphodimethylethanolamine, the two methylation steps required to convert phosphomonoethanolamine to phosphocholine. Unlike NMT1, NMT2 cannot utilize phosphoethanolamine as substrate in vitro. {ECO:0000269|PubMed:20650897}.
Pathway Phospholipid metabolism; phosphatidylcholine biosynthesis.
Sequence Caution Sequence=AAF79704.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAF79705.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the class I-like SAM-binding methyltransferase superfamily. PEAMT family. {ECO:0000255|PROSITE- ProRule:PRU00915}.
Subcellular Location Cytoplasm {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010902 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
42571805 RefSeq NP_973993 491 phosphoethanolamine N-methyltransferase 2
15221909 RefSeq NP_175293 475 phosphoethanolamine N-methyltransferase 2

Identical Sequences to LMP010902 proteins

Reference Database Accession Length Protein Name
GI:15221909 GenBank AAL16223.1 475 At1g48600/T1N15_20 [Arabidopsis thaliana]
GI:15221909 GenBank AAL36222.1 475 putative phosphoethanolamine N-methyltransferase [Arabidopsis thaliana]
GI:15221909 GenBank AAM91745.1 475 putative phosphoethanolamine N-methyltransferase [Arabidopsis thaliana]
GI:42571805 GenBank AEE32323.1 491 putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
GI:15221909 GenBank AEE32324.1 475 putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
GI:42571805 SwissProt Q944H0.2 491 RecName: Full=Phosphomethylethanolamine N-methyltransferase; Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]

Related Sequences to LMP010902 proteins

Reference Database Accession Length Protein Name
GI:42571805 GenBank AAL16223.1 475 At1g48600/T1N15_20 [Arabidopsis thaliana]
GI:15221909 GenBank EFH67704.1 491 hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. lyrata]
GI:42571805 GenBank EFH67704.1 491 hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. lyrata]
GI:15221909 GenBank AEE32323.1 491 putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
GI:42571805 GenBank AEE32324.1 475 putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
GI:42571805 GenBank EOA36885.1 491 hypothetical protein CARUB_v10008968mg [Capsella rubella]
GI:15221909 RefSeq NP_973993.1 491 phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
GI:42571805 RefSeq XP_002891445.1 491 hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. lyrata]
GI:15221909 RefSeq XP_002891445.1 491 hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. lyrata]
GI:42571805 RefSeq XP_006303987.1 491 hypothetical protein CARUB_v10008968mg [Capsella rubella]
GI:15221909 RefSeq XP_006303987.1 491 hypothetical protein CARUB_v10008968mg [Capsella rubella]
GI:15221909 SwissProt Q944H0.2 491 RecName: Full=Phosphomethylethanolamine N-methyltransferase; Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]