Gene/Proteome Database (LMPD)

LMPD ID
LMP010896
Gene ID
839335
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phospholipid sterol acyl transferase 1
Gene Symbol
PSAT1
Synonyms
ATPSAT1; F21M11.5; F21M11_5; phospholipid sterol acyl transferase 1; PSAT1
Alternate Names
phospholipid sterol acyl transferase 1
Chromosome
1
EC Number
2.3.1.-

Proteins

phospholipid sterol acyl transferase 1
Refseq ID NP_171897
Protein GI 145335059
UniProt ID Q4VCM1
mRNA ID NM_100282
Length 633
RefSeq Status REVIEWED
MGANSKSVTASFTVIAVFFLICGGRTAVEDETEFHGDYSKLSGIIIPGFASTQLRAWSILDCPYTPLDFNPLDLVWLDTTKLLSAVNCWFKCMVLDPYNQTDHPECKSRPDSGLSAITELDPGYITGPLSTVWKEWLKWCVEFGIEANAIVAVPYDWRLSPTKLEERDLYFHKLKLTFETALKLRGGPSIVFAHSMGNNVFRYFLEWLRLEIAPKHYLKWLDQHIHAYFAVGAPLLGSVEAIKSTLSGVTFGLPVSEGTARLLSNSFASSLWLMPFSKNCKGDNTFWTHFSGGAAKKDKRVYHCDEEEYQSKYSGWPTNIINIEIPSTSVTETALVNMTSMECGLPTLLSFTARELADGTLFKAIEDYDPDSKRMLHQLKKLYHDDPVFNPLTPWERPPIKNVFCIYGAHLKTEVGYYFAPSGKPYPDNWIITDIIYETEGSLVSRSGTVVDGNAGPITGDETVPYHSLSWCKNWLGPKVNITMAPQPEHDGSDVHVELNVDHEHGSDIIANMTKAPRVKYITFYEDSESIPGKRTAVWELDKTNHRNIVRSPVLMRELWLQMWHDIQPGAKSKFVTKAKRGPLRDADCYWDYGKACCAWQEYCEYRYSFGDVHLGQSCRLRNTSANMLLQYI

Gene Information

Entrez Gene ID
839335
Gene Name
phospholipid sterol acyl transferase 1
Gene Symbol
PSAT1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:TAIR C intracellular membrane-bounded organelle
GO:0080096 IDA:TAIR F phosphatidate-sterol O-acyltransferase activity
GO:0004607 IDA:TAIR F phosphatidylcholine-sterol O-acyltransferase activity
GO:0080095 IDA:TAIR F phosphatidylethanolamine-sterol O-acyltransferase activity
GO:0010150 IMP:TAIR P leaf senescence
GO:0016127 IMP:TAIR P sterol catabolic process
GO:0034434 IDA:TAIR P sterol esterification

BIOCYC Pathway Links

BIOCYC Pathway ID Description
TRIGLSYN-PWY triacylglycerol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR003386 Lecithin:cholesterol/phospholipid:diacylglycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
phospholipid sterol acyl transferase 1
Protein Entry
LCAT2_ARATH
UniProt ID
Q4VCM1
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype Early leaf senescence. Strong reduction in total sterol esters content in leaves and seeds. No change in flowers. {ECO:0000269|PubMed:16020547, ECO:0000269|PubMed:19923239}.
Function Involved in lipid catabolism. Essential for sterol esters biosynthesis in leaves and seeds, but not in flowers. Plays a role in controlling the free sterol content of leaves. Catalyzes the transacylation of acyl groups from phospholipids to a variety of different sterols. Prefers phosphatidylethanolamine over phosphatidylcholine as an acyl donor. Not active toward neutral lipids. Highly specific for position sn-2, which in plant lipids is essentially devoid of saturated acyl groups. Broad sterol specificity (cholesterol > campesterol > sitosterol > stigmasterol), but no activity with lupeol or beta-amyrin. {ECO:0000269|PubMed:16020547, ECO:0000269|PubMed:19923239}.
Induction By senescence. {ECO:0000269|PubMed:19923239}.
Sequence Caution Sequence=AAD10668.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the AB hydrolase superfamily. Lipase family. {ECO:0000305}.
Subcellular Location Microsome membrane {ECO:0000269|PubMed:16020547}; Single-pass type II membrane protein {ECO:0000269|PubMed:16020547}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010896 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
145335059 RefSeq NP_171897 633 phospholipid sterol acyl transferase 1

Identical Sequences to LMP010896 proteins

Reference Database Accession Length Protein Name
GI:145335059 GenBank AEE27645.1 633 phospholipid sterol acyl transferase 1 [Arabidopsis thaliana]
GI:145335059 SwissProt Q4VCM1.2 633 RecName: Full=Phospholipid--sterol O-acyltransferase; AltName: Full=Lecithin-cholesterol acyltransferase-like 2 [Arabidopsis thaliana]

Related Sequences to LMP010896 proteins

Reference Database Accession Length Protein Name
GI:145335059 GenBank AAY43920.1 633 phospholipid:sterol acyl transferase, partial [Arabidopsis thaliana]
GI:145335059 GenBank ACP74344.1 633 Sequence 9 from patent US 7498026
GI:145335059 GenBank EFH68452.1 633 phosphatidylcholine-sterol O-acyltransferase [Arabidopsis lyrata subsp. lyrata]
GI:145335059 RefSeq XP_002892193.1 633 phosphatidylcholine-sterol O-acyltransferase [Arabidopsis lyrata subsp. lyrata]
GI:145335059 RefSeq XP_010482950.1 633 PREDICTED: phospholipid--sterol O-acyltransferase-like [Camelina sativa]
GI:145335059 RefSeq XP_010457424.1 633 PREDICTED: phospholipid--sterol O-acyltransferase [Camelina sativa]