Gene/Proteome Database (LMPD)

LMPD ID
LMP010868
Gene ID
829068
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phospholipase A2-delta
Gene Symbol
AT4G29470
Synonyms
F17A13.290; F17A13_290
Alternate Names
phospholipase A2-delta
Chromosome
4
EC Number
3.1.1.4

Proteins

phospholipase A2-delta
Refseq ID NP_194676
Protein GI 30688340
UniProt ID Q8GV50
mRNA ID NM_119092
Length 191
RefSeq Status REVIEWED
MIRGGALTHVALGLTVFLLLAVVHSQEKCSKTCIAQKCNVLGIRYGKYCGIGYFGCPGEPPCDDLDDCCMTHDNCVDLKGMTYVDCHKQFQRCVNELKQSIQESNNQKVGFSKECPYSTVIPTVYRGMNYGIFFSGIGNIIIPKKPASAGPVVEVDLARSKADTKDGLGTNQGPQTKDGSKVSVPMNPSPS

Gene Information

Entrez Gene ID
829068
Gene Name
phospholipase A2-delta
Gene Symbol
AT4G29470
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004623 IEA:UniProtKB-EC F phospholipase A2 activity
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0006644 IEA:InterPro P phospholipid metabolic process
GO:0009555 IMP:TAIR P pollen development
GO:0009846 IDA:UniProtKB P pollen germination
GO:0009860 IDA:UniProtKB P pollen tube growth

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6803 phosphatidylcholine acyl editing
LIPASYN-PWY phospholipases

Domain Information

InterPro Annotations

Accession Description
IPR016090 Phospholipase A2 domain
IPR013090 Phospholipase A2, active site

UniProt Annotations

Entry Information

Gene Name
phospholipase A2-delta
Protein Entry
PLA2D_ARATH
UniProt ID
Q8GV50
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035}.
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Note=Binds 1 Ca(2+) ion per subunit.;
Developmental Stage Expressed during pollen germination and tube growth. {ECO:0000269|PubMed:21278126}.
Function PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Releases lysophospholipids (LPLs) and free fatty acids (FFAs) from membrane phospholipids in response to hormones and other external stimuli. Plays a role in pollen development and germination and tube growth. {ECO:0000269|PubMed:21278126}.
Miscellaneous The enzyme has a slight preference for phosphatidylethanolamine over phosphatidylcholine.
Sequence Caution Sequence=CAB79705.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the phospholipase A2 family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000250}. Endoplasmic reticulum {ECO:0000269|PubMed:21278126}.
Tissue Specificity Specifically expressed in flowers but at a low level. Detected specifically in the pollen. {ECO:0000269|PubMed:15748654, ECO:0000269|PubMed:21278126}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010868 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30688340 RefSeq NP_194676 191 phospholipase A2-delta

Identical Sequences to LMP010868 proteins

Reference Database Accession Length Protein Name
GI:30688340 DBBJ BAH30544.1 191 hypothetical protein, partial [Arabidopsis thaliana]
GI:30688340 GenBank AAN63045.1 191 phospholipase A2 delta [Arabidopsis thaliana]
GI:30688340 GenBank AEE85635.1 191 phospholipase A2-delta [Arabidopsis thaliana]
GI:30688340 SwissProt Q8GV50.1 191 RecName: Full=Phospholipase A2-delta; AltName: Full=Secretory phospholipase A2-delta; Short=AtsPLA2-delta; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010868 proteins

Reference Database Accession Length Protein Name
GI:30688340 GenBank EFH43664.1 191 hypothetical protein ARALYDRAFT_491810 [Arabidopsis lyrata subsp. lyrata]
GI:30688340 GenBank EOA17892.1 191 hypothetical protein CARUB_v10006301mg [Capsella rubella]
GI:30688340 RefSeq XP_002867405.1 191 hypothetical protein ARALYDRAFT_491810 [Arabidopsis lyrata subsp. lyrata]
GI:30688340 RefSeq XP_006284994.1 191 hypothetical protein CARUB_v10006301mg [Capsella rubella]
GI:30688340 RefSeq XP_010438297.1 191 PREDICTED: phospholipase A2-delta-like [Camelina sativa]
GI:30688340 RefSeq XP_010447850.1 191 PREDICTED: phospholipase A2-delta-like [Camelina sativa]