Gene/Proteome Database (LMPD)

LMPD ID
LMP010769
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
peroxygenase 2
Gene Symbol
Synonyms
ARABIDOPSIS THALIANA PEROXYGENASE 2; ATPXG2; MCO15.19; MCO15_19
Alternate Names
peroxygenase 2
Chromosome
5
EC Number
1.11.2.3

Proteins

peroxygenase 2
Refseq ID NP_200335
Protein GI 15240486
UniProt ID Q9FLN9
mRNA ID NM_124906
Length 243
RefSeq Status REVIEWED
MTSMERMERDAMETVAPYARVTYHRRVRGDLDDTLPKPYLPRALQAPDMEHPQGTPDHRHNGLSVLQQHVAFFDLDNNGIIYPFETFSGFRLLGFNLLASLILAAGINIALSYATLPGWLPSPFFPIYIHNIHKAKHGSDSKTYDNEGRYTPANLELMFSKYARTIPDKLSLGELWDMTEGNRDAFDFFGWLASKVEWGVLYALASDEEGFLSKEAIRRCFDGSLFEYCAKNYAEIKEYKTYY

Gene Information

Entrez Gene ID
Gene Name
peroxygenase 2
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IDA:TAIR C integral component of membrane
GO:0005811 IEA:UniProtKB-KW C lipid particle
GO:0005509 IDA:TAIR F calcium ion binding
GO:0004392 IDA:TAIR F heme oxygenase (decyclizing) activity
GO:0071614 IDA:TAIR F linoleic acid epoxygenase activity
GO:0004497 IDA:TAIR F monooxygenase activity
GO:1990137 IEA:UniProtKB-EC F plant seed peroxidase activity
GO:0006952 TAS:TAIR P defense response
GO:0031408 IDA:TAIR P oxylipin biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00073 Cutin, suberine and wax biosynthesis
ko00073 Cutin, suberine and wax biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR007736 Caleosin

UniProt Annotations

Entry Information

Gene Name
peroxygenase 2
Protein Entry
PXG2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity RH + ROOH = ROH + ROH. {ECO:0000269|PubMed:16956885}.
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
Cofactor Name=heme b; Xref=ChEBI:CHEBI:60344; Evidence={ECO:0000250}; Note=Binds 1 heme b (iron(II)-protoporphyrin IX) group. {ECO:0000250};
Domain The proline-knot motif (117-126) may be involved in targeting to lipid bodies.
Domain Transmembrane regions are predicted by sequence analysis tools, but these regions probably constitute hydrophobic domains associated to phospholipids.
Function Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline and epoxidation of oleic acid. {ECO:0000269|PubMed:15678336}.
Induction Down-regulated by light and upon germination. Not induced by abscisic acid or osmotic stress. {ECO:0000269|PubMed:11197322, ECO:0000269|PubMed:15678336}.
Similarity Belongs to the caleosin family. {ECO:0000305}.
Similarity Contains 1 EF-hand domain. {ECO:0000305}.
Subcellular Location Lipid droplet {ECO:0000269|PubMed:21751352}.
Subunit Homodimer. {ECO:0000250}.
Tissue Specificity Expressed in roots, cotyledons, hypocotyls, leaves, shoots, flowers, siliques and dry seeds. {ECO:0000269|PubMed:11197322, ECO:0000269|PubMed:15678336}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010769 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15240486 RefSeq NP_200335 243 peroxygenase 2

Identical Sequences to LMP010769 proteins

Reference Database Accession Length Protein Name
GI:15240486 EMBL CAW35328.1 243 unnamed protein product [Arabidopsis thaliana]
GI:15240486 EMBL CAW44114.1 243 unnamed protein product [Arabidopsis thaliana]
GI:15240486 EMBL CBC01362.1 243 unnamed protein product [Arabidopsis thaliana]
GI:15240486 EMBL CBC09623.1 243 unnamed protein product [Arabidopsis thaliana]
GI:15240486 GenBank ACW88438.1 243 Sequence 5502 from patent US 7569389
GI:15240486 gnl TAIR 243 peroxygenase 2 [Arabidopsis thaliana]

Related Sequences to LMP010769 proteins

Reference Database Accession Length Protein Name
GI:15240486 GenBank ACW88437.1 255 Sequence 5501 from patent US 7569389
GI:15240486 GenBank ACW88439.1 240 Sequence 5503 from patent US 7569389
GI:15240486 GenBank EFH40645.1 243 hypothetical protein ARALYDRAFT_495609 [Arabidopsis lyrata subsp. lyrata]
GI:15240486 RefSeq XP_002864386.1 243 hypothetical protein ARALYDRAFT_495609 [Arabidopsis lyrata subsp. lyrata]
GI:15240486 RefSeq XP_010449309.1 243 PREDICTED: peroxygenase 2-like [Camelina sativa]
GI:15240486 RefSeq XP_010482957.1 243 PREDICTED: peroxygenase 2 isoform X1 [Camelina sativa]