Gene/Proteome Database (LMPD)

LMPD ID
LMP010756
Gene ID
832812
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
peroxisomal adenine nucleotide carrier 2
Gene Symbol
PNC2
Synonyms
F21A20.230; F21A20_230; peroxisomal adenine nucleotide carrier 2; PNC2
Alternate Names
peroxisomal adenine nucleotide carrier 2
Chromosome
5

Proteins

peroxisomal adenine nucleotide carrier 2
Refseq ID NP_198104
Protein GI 15240964
UniProt ID Q8VZS0
mRNA ID NM_122634
Length 321
RefSeq Status REVIEWED
MGVDLDLESISEATSGAIGSLLSTTILYPLDTCKSKFQAEIRVRGQQKYRYLSDVFWEAISSGNVLSLYQGLGTKNLQSFISSFIYFYSYSYFKRLHSQRIGSKSIGTKANLLIAAAAGACTSVLTQPLDTASSRMQTSEFGKSKGLWKTLTDGSWGNAFDGLGISLLLTSNPAIQYTVFDQLKQNLLEKGKAKSNKDSSPVVLSAFMAFVLGAVSKSAATVITYPAIRCKVMIQAADDSKENEAKKPRKRIRKTIPGVVYAIWKKEGILGFFKGLQAQILKTVLSSALLLMIKEKITATTWILILAIRTLFVTKARLKSP

Gene Information

Entrez Gene ID
832812
Gene Name
peroxisomal adenine nucleotide carrier 2
Gene Symbol
PNC2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005777 IDA:TAIR C peroxisome
GO:0015217 IDA:TAIR F ADP transmembrane transporter activity
GO:0005347 IDA:TAIR F ATP transmembrane transporter activity
GO:0015297 IEA:UniProtKB-KW F antiporter activity
GO:0015866 IDA:TAIR P ADP transport
GO:0015867 IDA:TAIR P ATP transport
GO:0006635 IMP:TAIR P fatty acid beta-oxidation
GO:0080024 IMP:TAIR P indolebutyric acid metabolic process
GO:0090351 IGI:TAIR P seedling development

Domain Information

InterPro Annotations

Accession Description
IPR023395 Mitochondrial carrier domain
IPR018108 Mitochondrial substrate/solute carrier

UniProt Annotations

Entry Information

Gene Name
peroxisomal adenine nucleotide carrier 2
Protein Entry
PNC2_ARATH
UniProt ID
Q8VZS0
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=150 uM for ATP {ECO:0000269|PubMed:19073763};
Developmental Stage Expressed in the early seedling stage of post-germinative growth. {ECO:0000269|PubMed:19073762}.
Function Peroxisomal adenine nucleotide transporter catalyzing the counterexchange of ATP with AMP. ATP is needed by reactions that generate acyl-CoA for peroxisomal fatty acid beta-oxidation during postgerminative growth. Required for the beta-oxidation reactions involved in auxin biosynthesis and for the conversion of seed-reserved triacylglycerols into sucrose that is necessary for growth before the onset of photosynthesis. {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}.
Similarity Belongs to the mitochondrial carrier (TC 2.A.29) family. {ECO:0000305}.
Similarity Contains 3 Solcar repeats. {ECO:0000255|PROSITE- ProRule:PRU00282}.
Subcellular Location Peroxisome membrane {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}; Multi- pass membrane protein {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}.
Tissue Specificity Expressed in stamens, pollen grains, seeds, leaves, cotyledons, roots, stems, flowers, hypocotyls and siliques. {ECO:0000269|PubMed:19073763}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010756 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15240964 RefSeq NP_198104 321 peroxisomal adenine nucleotide carrier 2

Identical Sequences to LMP010756 proteins

Reference Database Accession Length Protein Name
GI:15240964 GenBank AAL36248.1 321 unknown protein [Arabidopsis thaliana]
GI:15240964 GenBank AAM67452.1 321 unknown protein [Arabidopsis thaliana]
GI:15240964 gnl TAIR 321 peroxisomal adenine nucleotide carrier 2 [Arabidopsis thaliana]
GI:15240964 SwissProt Q8VZS0.1 321 RecName: Full=Peroxisomal adenine nucleotide carrier 2 [Arabidopsis thaliana]

Related Sequences to LMP010756 proteins

Reference Database Accession Length Protein Name
GI:15240964 GenBank EFH48527.1 321 mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata]
GI:15240964 GenBank EOA21127.1 321 hypothetical protein CARUB_v10001469mg [Capsella rubella]
GI:15240964 GenBank ESQ32248.1 321 hypothetical protein EUTSA_v10004605mg [Eutrema salsugineum]
GI:15240964 RefSeq XP_002872268.1 321 mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata]
GI:15240964 RefSeq XP_006288229.1 321 hypothetical protein CARUB_v10001469mg [Capsella rubella]
GI:15240964 RefSeq XP_006394962.1 321 hypothetical protein EUTSA_v10004605mg [Eutrema salsugineum]