Gene/Proteome Database (LMPD)
Proteins
| patellin-6 | |
|---|---|
| Refseq ID | NP_190735 |
| Protein GI | 15230555 |
| UniProt ID | Q9SCU1 |
| mRNA ID | NM_115026 |
| Length | 409 |
| RefSeq Status | REVIEWED |
| MDASLSPFDHQKTQNTEPKKSFITSLITLRSNNIKEDTYFVSELKPTEQKSLQELKEKLSASSSKASSMWGVSLLGGDDKADVILLKFLRARDFKVADSLRMLEKCLEWREEFKAEKLTEEDLGFKDLEGKVAYMRGYDKEGHPVCYNAYGVFKEKEMYERVFGDEEKLNKFLRWRVQVLERGVKMLHFKPGGVNSIIQVTDLKDMPKRELRVASNQILSLFQDNYPELVATKIFINVPWYFSVIYSMFSPFLTQRTKSKFVMSKEGNAAETLYKFIRPEDIPVQYGGLSRPTDSQNGPPKPASEFSIKGGEKVNIQIEGIEGGATITWDIVVGGWDLEYSAEFVPNAEESYAIVVEKPKKMKATDEAVCNSFTTVEAGKLILSVDNTLSRKKKVAAYRYTVRKSTTTV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0005886 | IDA:TAIR | C | plasma membrane |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0007049 | IEA:UniProtKB-KW | P | cell cycle |
| GO:0051301 | IEA:UniProtKB-KW | P | cell division |
| GO:0006810 | IEA:UniProtKB-KW | P | transport |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Carrier protein that may be involved in membrane- trafficking events associated with cell-plate formation during cytokinesis. Binds to some hydrophobic molecules such as phosphoinositides and promotes their transfer between the different cellular sites (By similarity). {ECO:0000250}. |
| Miscellaneous | 'Patella' means 'small plate' in Latin. |
| Sequence Caution | Sequence=CAB43521.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the patellin family. {ECO:0000305}. |
| Similarity | Contains 1 CRAL-TRIO domain. {ECO:0000255|PROSITE- ProRule:PRU00056}. |
| Similarity | Contains 1 GOLD domain. {ECO:0000255|PROSITE- ProRule:PRU00096}. |
| Subcellular Location | Membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. Cytoplasm {ECO:0000250}. Note=Mainly membrane-associated. Also cytoplasmic (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010744 (as displayed in Record Overview)
Identical Sequences to LMP010744 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15230555 | EMBL | CAB63153.1 | 409 | putative protein [Arabidopsis thaliana] |
| GI:15230555 | EMBL | CBX86384.1 | 409 | unnamed protein product [Arabidopsis thaliana] |
| GI:15230555 | GenBank | AAL31927.1 | 409 | AT3g51670/T18N14_50 [Arabidopsis thaliana] |
| GI:15230555 | GenBank | AAN73306.1 | 409 | At3g51670/T18N14_50 [Arabidopsis thaliana] |
| GI:15230555 | GenBank | AEE78825.1 | 409 | patellin-6 [Arabidopsis thaliana] |
| GI:15230555 | SwissProt | Q9SCU1.1 | 409 | RecName: Full=Patellin-6 [Arabidopsis thaliana] |
Related Sequences to LMP010744 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15230555 | GenBank | EFH52357.1 | 409 | SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15230555 | GenBank | ESQ45347.1 | 412 | hypothetical protein EUTSA_v10010417mg [Eutrema salsugineum] |
| GI:15230555 | RefSeq | XP_002876098.1 | 409 | SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15230555 | RefSeq | XP_010503862.1 | 411 | PREDICTED: patellin-6-like [Camelina sativa] |
| GI:15230555 | RefSeq | XP_010515597.1 | 411 | PREDICTED: patellin-6 [Camelina sativa] |
| GI:15230555 | RefSeq | XP_010426743.1 | 413 | PREDICTED: patellin-6-like [Camelina sativa] |