Gene/Proteome Database (LMPD)
LMPD ID
LMP010729
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Gene Symbol
Synonyms
ADS3; FAD5; FADB; fatty acid desaturase 5; FATTY ACID DESATURASE B; JB67
Alternate Names
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Chromosome
3
EC Number
1.14.19.-
Summary
Chloroplastic enzyme responsible for the synthesis of 16:1 fatty acids from galactolipids and sulpholipids. Uses ferredoxin as electron donor.
Orthologs
Proteins
| palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase | |
|---|---|
| Refseq ID | NP_566529 |
| Protein GI | 18400926 |
| UniProt ID | Q949X0 |
| mRNA ID | NM_112455 |
| Length | 371 |
| RefSeq Status | REVIEWED |
| MASLLTKPKPVFLCSPSLSPRTLNTATPSLNFTRISFTHHQKLAPFKPPSLVVAFSEKGLKRDVTTAAAATEGDYRRIMLSDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMHLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQGNPIDWVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMFDTNTITQRCGEPNNVGDLEKQPFYRFLRTTYILHPLALAVALYAMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGKQAWNTGDLSKNNWWVAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVKFLQAIGLATDVKLPSEAQKQRMAFTSD | |
Gene Information
Entrez Gene ID
Gene Name
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IEA:UniProtKB-KW | C | chloroplast |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0009579 | TAS:TAIR | C | thylakoid |
| GO:0016717 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water |
| GO:0031408 | IEA:UniProtKB-UniPathway | P | oxylipin biosynthetic process |
| GO:0010205 | IMP:TAIR | P | photoinhibition |
| GO:0006636 | IMP:TAIR | P | unsaturated fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01040 | Biosynthesis of unsaturated fatty acids |
| ko01040 | Biosynthesis of unsaturated fatty acids |
| ath01212 | Fatty acid metabolism |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-782 | glycolipid desaturation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Protein Entry
ADS3_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}. |
| Function | Involved in the first desaturation step leading to the formation of hexadeca 7,10,13-trienoic acid, the major functional components of thylakoid membranes. Also indirectly involved in the production of the oxylipin dinor-oxo-phyto-dienoic acid implicated in wound signaling. {ECO:0000269|PubMed:15240892, ECO:0000269|PubMed:15579662}. |
| Miscellaneous | Substrate specificity shifts from delta-7 to delta- 9 desaturation when the protein is retargeted to the cytoplasm. |
| Pathway | Lipid metabolism; oxylipin biosynthesis. |
| Pathway | Lipid metabolism; polyunsaturated fatty acid biosynthesis. |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast membrane; Multi-pass membrane protein. |
| Tissue Specificity | Highly expressed in young leaves. Low expression in roots. {ECO:0000269|PubMed:15579662}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010729 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18400926 | RefSeq | NP_566529 | 371 | palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase |
Identical Sequences to LMP010729 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18400926 | DBBJ | BAD23903.1 | 371 | monogalactosyldiacylglycerol-specific palmitic acid desaturase [Arabidopsis thaliana] |
| GI:18400926 | GenBank | AAN41357.1 | 371 | putative delta 9 desaturase [Arabidopsis thaliana] |
| GI:18400926 | GenBank | AAW51920.1 | 371 | palmitoyl-monogalactosyldiacylglycerol delta7-desaturase [Arabidopsis thaliana] |
| GI:18400926 | GenBank | AED84899.1 | 371 | Sequence 33 from patent US 7923223 |
| GI:18400926 | GenBank | AEE75737.1 | 371 | palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase [Arabidopsis thaliana] |
| GI:18400926 | SwissProt | Q949X0.2 | 371 | RecName: Full=Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic; AltName: Full=FAD5; AltName: Full=Monogalactosyldiacylglycerol-specific palmitic acid desaturase; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010729 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18400926 | GenBank | AAK92773.1 | 371 | putative delta 9 desaturase [Arabidopsis thaliana] |
| GI:18400926 | GenBank | AAM63459.1 | 371 | putative delta 9 desaturase [Arabidopsis thaliana] |
| GI:18400926 | GenBank | ADF00737.1 | 371 | Sequence 6 from patent US 7655833 |
| GI:18400926 | GenBank | EFH59226.1 | 371 | hypothetical protein ARALYDRAFT_479040 [Arabidopsis lyrata subsp. lyrata] |
| GI:18400926 | RefSeq | XP_002882967.1 | 371 | hypothetical protein ARALYDRAFT_479040 [Arabidopsis lyrata subsp. lyrata] |
| GI:18400926 | RefSeq | XP_006297956.1 | 368 | hypothetical protein CARUB_v10013996mg [Capsella rubella] |