Gene/Proteome Database (LMPD)

LMPD ID
LMP010729
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Gene Symbol
Synonyms
ADS3; FAD5; FADB; fatty acid desaturase 5; FATTY ACID DESATURASE B; JB67
Alternate Names
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Chromosome
3
EC Number
1.14.19.-
Summary
Chloroplastic enzyme responsible for the synthesis of 16:1 fatty acids from galactolipids and sulpholipids. Uses ferredoxin as electron donor.
Orthologs

Proteins

palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Refseq ID NP_566529
Protein GI 18400926
UniProt ID Q949X0
mRNA ID NM_112455
Length 371
RefSeq Status REVIEWED
MASLLTKPKPVFLCSPSLSPRTLNTATPSLNFTRISFTHHQKLAPFKPPSLVVAFSEKGLKRDVTTAAAATEGDYRRIMLSDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMHLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQGNPIDWVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMFDTNTITQRCGEPNNVGDLEKQPFYRFLRTTYILHPLALAVALYAMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGKQAWNTGDLSKNNWWVAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVKFLQAIGLATDVKLPSEAQKQRMAFTSD

Gene Information

Entrez Gene ID
Gene Name
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IEA:UniProtKB-KW C chloroplast
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0009579 TAS:TAIR C thylakoid
GO:0016717 IEA:InterPro F oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0031408 IEA:UniProtKB-UniPathway P oxylipin biosynthetic process
GO:0010205 IMP:TAIR P photoinhibition
GO:0006636 IMP:TAIR P unsaturated fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01040 Biosynthesis of unsaturated fatty acids
ko01040 Biosynthesis of unsaturated fatty acids
ath01212 Fatty acid metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-782 glycolipid desaturation

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR015876 Fatty acid desaturase, type 1, core

UniProt Annotations

Entry Information

Gene Name
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Protein Entry
ADS3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}.
Function Involved in the first desaturation step leading to the formation of hexadeca 7,10,13-trienoic acid, the major functional components of thylakoid membranes. Also indirectly involved in the production of the oxylipin dinor-oxo-phyto-dienoic acid implicated in wound signaling. {ECO:0000269|PubMed:15240892, ECO:0000269|PubMed:15579662}.
Miscellaneous Substrate specificity shifts from delta-7 to delta- 9 desaturation when the protein is retargeted to the cytoplasm.
Pathway Lipid metabolism; oxylipin biosynthesis.
Pathway Lipid metabolism; polyunsaturated fatty acid biosynthesis.
Similarity Belongs to the fatty acid desaturase family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast membrane; Multi-pass membrane protein.
Tissue Specificity Highly expressed in young leaves. Low expression in roots. {ECO:0000269|PubMed:15579662}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010729 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18400926 RefSeq NP_566529 371 palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase

Identical Sequences to LMP010729 proteins

Reference Database Accession Length Protein Name
GI:18400926 DBBJ BAD23903.1 371 monogalactosyldiacylglycerol-specific palmitic acid desaturase [Arabidopsis thaliana]
GI:18400926 GenBank AAN41357.1 371 putative delta 9 desaturase [Arabidopsis thaliana]
GI:18400926 GenBank AAW51920.1 371 palmitoyl-monogalactosyldiacylglycerol delta7-desaturase [Arabidopsis thaliana]
GI:18400926 GenBank AED84899.1 371 Sequence 33 from patent US 7923223
GI:18400926 GenBank AEE75737.1 371 palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase [Arabidopsis thaliana]
GI:18400926 SwissProt Q949X0.2 371 RecName: Full=Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic; AltName: Full=FAD5; AltName: Full=Monogalactosyldiacylglycerol-specific palmitic acid desaturase; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010729 proteins

Reference Database Accession Length Protein Name
GI:18400926 GenBank AAK92773.1 371 putative delta 9 desaturase [Arabidopsis thaliana]
GI:18400926 GenBank AAM63459.1 371 putative delta 9 desaturase [Arabidopsis thaliana]
GI:18400926 GenBank ADF00737.1 371 Sequence 6 from patent US 7655833
GI:18400926 GenBank EFH59226.1 371 hypothetical protein ARALYDRAFT_479040 [Arabidopsis lyrata subsp. lyrata]
GI:18400926 RefSeq XP_002882967.1 371 hypothetical protein ARALYDRAFT_479040 [Arabidopsis lyrata subsp. lyrata]
GI:18400926 RefSeq XP_006297956.1 368 hypothetical protein CARUB_v10013996mg [Capsella rubella]