Gene/Proteome Database (LMPD)
LMPD ID
LMP010728
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
fatty acyl-ACP thioesterases B
Gene Symbol
Synonyms
fatty acyl-ACP thioesterases B; T27G7.19; T27G7_19
Alternate Names
fatty acyl-ACP thioesterases B
Chromosome
1
EC Number
3.1.2.-
Summary
Encodes an acyl-acyl carrier protein thioesterase. Hydrolyzes primarily saturated acyl-ACPs with chain lengths that vary between 8 and 18 carbons. Involved in saturated fatty acid synthesis. Nuclear-encoded, plastid-targeted globular protein that is functional as dimer.
Orthologs
Proteins
| fatty acyl-ACP thioesterases B | |
|---|---|
| Refseq ID | NP_172327 |
| Protein GI | 15223236 |
| UniProt ID | Q9SJE2 |
| mRNA ID | NM_100724 |
| Length | 412 |
| RefSeq Status | REVIEWED |
| MVATSATSSFFPVPSSSLDPNGKGNKIGSTNLAGLNSAPNSGRMKVKPNAQAPPKINGKKVGLPGSVDIVRTDTETSSHPAPRTFINQLPDWSMLLAAITTIFLAAEKQWMMLDWKPRRSDMLVDPFGIGRIVQDGLVFRQNFSIRSYEIGADRSASIETVMNHLQETALNHVKTAGLLGDGFGSTPEMFKKNLIWVVTRMQVVVDKYPTWGDVVEVDTWVSQSGKNGMRRDWLVRDCNTGETLTRASSVWVMMNKLTRRLSKIPEEVRGEIEPYFVNSDPVLAEDSRKLTKIDDKTADYVRSGLTPRWSDLDVNQHVNNVKYIGWILESAPVGIMERQKLKSMTLEYRRECGRDSVLQSLTAVTGCDIGNLATAGDVECQHLLRLQDGAEVVRGRTEWSSKTPTTTWGTAP | |
Gene Information
Entrez Gene ID
Gene Name
fatty acyl-ACP thioesterases B
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IEA:UniProtKB-KW | C | chloroplast |
| GO:0009536 | TAS:TAIR | C | plastid |
| GO:0000036 | IDA:TAIR | F | ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process |
| GO:0016297 | IDA:TAIR | F | acyl-[acyl-carrier-protein] hydrolase activity |
| GO:0006633 | IMP:TAIR | P | fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath00061 | Fatty acid biosynthesis |
| ath01212 | Fatty acid metabolism |
| ath01100 | Metabolic pathways |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-5366 | palmitoleate biosynthesis II |
Domain Information
UniProt Annotations
Entry Information
Gene Name
fatty acyl-ACP thioesterases B
Protein Entry
FATB_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=2.9 uM for myristoyl-ACP (14:0-ACP) {ECO:0000269|PubMed:12061798}; KM=4.0 uM for myristoleoyl-ACP (14:1-ACP) {ECO:0000269|PubMed:12061798}; KM=3.8 uM for palmitoyl-ACP (16:0-ACP) {ECO:0000269|PubMed:12061798}; KM=2.6 uM for palmitoleoyl-ACP (16:1-ACP) {ECO:0000269|PubMed:12061798}; KM=3.0 uM for stearoyl-ACP (18:0-ACP) {ECO:0000269|PubMed:12061798}; KM=2.6 uM for oleoyl-ACP (18:1-ACP) {ECO:0000269|PubMed:12061798}; Note=The catalytic efficiency for 16:0 is at least 2-fold higher than for other substrates.; pH dependence: Optimum pH is 9.7 {ECO:0000269|PubMed:7840673}; |
| Catalytic Activity | Palmitoyl-[acyl-carrier-protein] + H(2)O = [acyl-carrier-protein] + palmitate. {ECO:0000269|PubMed:12061798, ECO:0000269|PubMed:7840673}. |
| Disruption Phenotype | Retarded growth, deformed seeds with low rate of germination and reduced levels of palmitate and stearate. {ECO:0000269|PubMed:12671095, ECO:0000269|PubMed:18263779, ECO:0000269|PubMed:18326828}. |
| Function | Plays an essential role in chain termination during de novo fatty acid synthesis. Possesses high thioesterase activity for palmitoyl-ACP versus other acyl-ACPs. Substrate preference is 16:0 > 18:1 > 18:0 > 16:1. Plays an essential role in the supply of saturated fatty acids necessary for plant growth and seed development. Contributes to 16:0 production particularly in flowers. May be involved in the synthesis of long chain fatty acid. {ECO:0000269|PubMed:10859193, ECO:0000269|PubMed:12061798, ECO:0000269|PubMed:12671095, ECO:0000269|PubMed:15531590, ECO:0000269|PubMed:18263779, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:7840673}. |
| Miscellaneous | Plants silencing FATB, show reduced level of palmitate in flowers and seeds. {ECO:0000305|PubMed:10859193}. |
| Similarity | Belongs to the acyl-ACP thioesterase family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast {ECO:0000305}. |
| Tissue Specificity | Highly expressed in flowers. Expressed in roots, leaves, stems, siliques and seeds. {ECO:0000269|PubMed:10859193, ECO:0000269|PubMed:7840673}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010728 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15223236 | RefSeq | NP_172327 | 412 | fatty acyl-ACP thioesterases B |
Identical Sequences to LMP010728 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15223236 | GenBank | AEE28300.1 | 412 | fatty acyl-ACP thioesterases B [Arabidopsis thaliana] |
| GI:15223236 | GenBank | AGE99615.1 | 412 | Sequence 2 from patent US 8361173 |
| GI:15223236 | GenBank | AGF22772.1 | 412 | Sequence 68 from patent US 8372610 |
| GI:15223236 | GenBank | AGV92057.1 | 412 | Sequence 210 from patent US 8530221 |
| GI:15223236 | GenBank | AHE24007.1 | 412 | Sequence 208 from patent US 8592188 |
| GI:15223236 | SwissProt | Q9SJE2.1 | 412 | RecName: Full=Palmitoyl-acyl carrier protein thioesterase, chloroplastic; AltName: Full=16:0-acyl-carrier protein thioesterase; Short=16:0-ACP thioesterase; AltName: Full=Acyl-[acyl-carrier-protein] hydrolase; AltName: Full=Acyl-acyl carrier protein thioesterase B1; Short=AtFATB1; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010728 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15223236 | EMBL | CAA85387.1 | 412 | acyl-(acyl carrier protein) thioesterase [Arabidopsis thaliana] |
| GI:15223236 | EMBL | CAA85388.1 | 412 | acyl-(acyl carrier protein) thioesterase [Arabidopsis thaliana] |
| GI:15223236 | GenBank | EFH68720.1 | 411 | fatty acyl-acp thioesterases B [Arabidopsis lyrata subsp. lyrata] |
| GI:15223236 | GenBank | AHE24008.1 | 412 | Sequence 209 from patent US 8592188 |
| GI:15223236 | GenBank | AHE24009.1 | 412 | Sequence 210 from patent US 8592188 |
| GI:15223236 | RefSeq | XP_002892461.1 | 411 | fatty acyl-acp thioesterases B [Arabidopsis lyrata subsp. lyrata] |