Gene/Proteome Database (LMPD)

LMPD ID
LMP010710
Gene ID
820387
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
omega-6 fatty acid desaturase
Gene Symbol
FAD2
Synonyms
DELTA-12 DESATURASE; FAD2; fatty acid desaturase 2
Alternate Names
omega-6 fatty acid desaturase
Chromosome
3
EC Number
1.14.19.-
Summary
Major enzyme responsible for the synthesis of 18:2 fatty acids in the endoplasmic reticulum. Contains His-rich motifs, which contribute to the interaction with the electron donor cytochrome b5. Mutations in this gene suppress the low temperature-induced phenotype of Arabidopsis tocopherol-deficient mutant vte2.
Orthologs
View orthologs and multiple alignments for FAD2

Proteins

omega-6 fatty acid desaturase
Refseq ID NP_001078140
Protein GI 145332367
UniProt ID P46313
mRNA ID NM_001084671
Length 383
RefSeq Status REVIEWED
MGAGGRMPVPTSSKKSETDTTKRVPCEKPPFSVGDLKKAIPPHCFKRSIPRSFSYLISDIIIASCFYYVATNYFSLLPQPLSYLAWPLYWACQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIYLSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSEWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQFDGTPWYVAMYREAKECIYVEPDREGDKKGVYWYNNKL
omega-6 fatty acid desaturase
Refseq ID NP_187819
Protein GI 15229956
UniProt ID P46313
mRNA ID NM_112047
Length 383
RefSeq Status REVIEWED
Protein sequence is identical to GI:145332367 (mRNA isoform)

Gene Information

Entrez Gene ID
820387
Gene Name
omega-6 fatty acid desaturase
Gene Symbol
FAD2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0045485 IDA:TAIR F omega-6 fatty acid desaturase activity
GO:0016717 IEA:InterPro F oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0006636 IEA:UniProtKB-UniPathway P unsaturated fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01040 Biosynthesis of unsaturated fatty acids
ath01212 Fatty acid metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-762 phospholipid desaturation
PWY-762 phospholipid desaturation

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR021863 Protein of unknown function DUF3474

UniProt Annotations

Entry Information

Gene Name
omega-6 fatty acid desaturase
Protein Entry
FAD6E_ARATH
UniProt ID
P46313
Species
Arabidopsis

Comments

Comment Type Description
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Function ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes. It is thought to use cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and, possibly, other phospholipids.
Pathway Lipid metabolism; polyunsaturated fatty acid biosynthesis.
Similarity Belongs to the fatty acid desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP010710 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
145332367 RefSeq NP_001078140 383 omega-6 fatty acid desaturase

Identical Sequences to LMP010710 proteins

Reference Database Accession Length Protein Name
GI:145332367 GenBank AEE75152.1 383 omega-6 fatty acid desaturase [Arabidopsis thaliana]
GI:145332367 GenBank AEE75153.1 383 omega-6 fatty acid desaturase [Arabidopsis thaliana]
GI:145332367 GenBank AEF65865.1 383 Sequence 125 from patent US 7932435
GI:145332367 GenBank AEF76521.1 383 Sequence 125 from patent US 7939713
GI:145332367 GenBank AEN55368.1 383 Sequence 5 from patent US 8003853
GI:145332367 GenBank AEN55388.1 383 Sequence 6 from patent US 8003855

Related Sequences to LMP010710 proteins

Reference Database Accession Length Protein Name
GI:145332367 GenBank AAM61113.1 383 omega-6 fatty acid desaturase, endoplasmic reticulum (FAD2) [Arabidopsis thaliana]
GI:145332367 GenBank EFH61142.1 383 hypothetical protein ARALYDRAFT_478568 [Arabidopsis lyrata subsp. lyrata]
GI:145332367 GenBank ADN10828.1 383 fatty acid desaturase [Arabidopsis lyrata]
GI:145332367 GenBank ADN10834.1 384 fatty acid desaturase [Camelina rumelica]
GI:145332367 GenBank AFL64790.1 383 Sequence 30 from patent US 8188339
GI:145332367 RefSeq XP_002884883.1 383 hypothetical protein ARALYDRAFT_478568 [Arabidopsis lyrata subsp. lyrata]