LIPID MAPS

LMPD ID

LMP010693

Gene ID

839462

Species

Arabidopsis thaliana (Arabidopsis)

Gene Name

lipoyltransferase 2

Gene Symbol

LIP2

Synonyms

lipoyltransferase 2

Alternate Names

lipoyltransferase 2

Chromosome

1

EC Number

2.3.1.181

Summary

Lipoyltransferase, located in mitochondria but not found in chloroplasts

Orthologs

View orthologs and multiple alignments for LIP2

lipoyltransferase 2
Refseq ID	NP_001030961
Protein GI	79316647
UniProt ID	Q9SXP7
mRNA ID	NM_001035884
Length	235
RefSeq Status	REVIEWED
MRSPRTLEVWKLGTVNYLKSLKLQEKLVSERKAHQIPDTLLSLQHPPTYTLGKRRTDHNLLIPESELTKIGAELHYTQRGGDITFHGPHQAILYPIISLRSIGFGARNYVETLERSMIEFASIYGVKARAGNKCETGVWVGDRKIGAIGVRISSGITSHGLALNIDPDMKYFEHIVPCGIADKEVTSLRRETDTLLPSEEVIHEQLVSCLAKAFSYDDVVWKEDPSLILDTQDKE

lipoyltransferase 2
Refseq ID	NP_171958
Protein GI	15219770
UniProt ID	Q9SXP7
mRNA ID	NM_100343
Length	235
RefSeq Status	REVIEWED
Protein sequence is identical to GI:79316647 (mRNA isoform)

Entrez Gene ID

839462

Gene Name

lipoyltransferase 2

Gene Symbol

LIP2

Species

Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0005739	IDA:TAIR	C	mitochondrion
GO:0033819	IDA:UniProtKB	F	lipoyl(octanoyl) transferase activity
GO:0017118	IGI:TAIR	F	lipoyltransferase activity
GO:0016415	IEA:InterPro	F	octanoyltransferase activity
GO:0009107	IEA:InterPro	P	lipoate biosynthetic process
GO:0009106	IGI:TAIR	P	lipoate metabolic process
GO:0009249	IDA:UniProtKB	P	protein lipoylation

KEGG Pathway Links

KEGG Pathway ID	Description
ath00785	Lipoic acid metabolism
ko00785	Lipoic acid metabolism
ath01100	Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID	Description
PWY0-501	lipoate biosynthesis and incorporation I

InterPro Annotations

Accession	Description
IPR004143	Biotin/lipoate A/B protein ligase
IPR000544	Octanoyltransferase
IPR020605	Octanoyltransferase, conserved site

Entry Information

Gene Name

lipoyltransferase 2

Protein Entry

LIPB_ARATH

UniProt ID

Q9SXP7

Species

Arabidopsis

Comments

Comment Type	Description
Catalytic Activity	Octanoyl-[acyl-carrier-protein] + protein = protein N(6)-(octanoyl)lysine + [acyl-carrier-protein].
Function	Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate (Probable). {ECO:0000305\|PubMed:11427685}.
Miscellaneous	In the reaction, the free carboxyl group of octanoic acid is attached via an amide linkage to the epsilon- amino group of a specific lysine residue of lipoyl domains of lipoate-dependent enzymes. {ECO:0000250}.
Pathway	Protein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier- protein]: step 1/2.
Sequence Caution	Sequence=AAB80636.1; Type=Erroneous gene model prediction; Note=The predicted gene At1g04640 has been split into 2 genes: At1g04635 and At1g04640.; Evidence={ECO:0000305};
Similarity	Belongs to the LipB family. {ECO:0000305}.
Similarity	Contains 1 BPL/LPL catalytic domain. {ECO:0000255\|PROSITE-ProRule:PRU01067}.
Tissue Specificity	Expressed in leaves. {ECO:0000269\|PubMed:11427685}.

Unique RefSeq proteins for LMP010693 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
79316647	RefSeq	NP_001030961	235	lipoyltransferase 2

Identical Sequences to LMP010693 proteins

Reference	Database	Accession	Length	Protein Name
GI:79316647	EMBL	CAE00135.1	235	unnamed protein product [Arabidopsis thaliana]
GI:79316647	GenBank	AAL16120.1	235	At1g04640/T1G11_10 [Arabidopsis thaliana]
GI:79316647	GenBank	AAM91458.1	235	At1g04640/T1G11_10 [Arabidopsis thaliana]
GI:79316647	GenBank	AEE27726.1	235	lipoyltransferase 2 [Arabidopsis thaliana]
GI:79316647	GenBank	AEE27727.1	235	lipoyltransferase 2 [Arabidopsis thaliana]
GI:79316647	SwissProt	Q9SXP7.1	235	RecName: Full=Octanoyltransferase; AltName: Full=Lipoate biosynthesis protein; AltName: Full=Lipoate-protein ligase; AltName: Full=Lipoyl ligase; AltName: Full=Lipoyl/octanoyl transferase; AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase [Arabidopsis thaliana]

Related Sequences to LMP010693 proteins

Reference	Database	Accession	Length	Protein Name
GI:79316647	GenBank	AAB80636.1	333	Contains similarity to Mycobacterium LIPB gene (gb\|Q104041) [Arabidopsis thaliana]
GI:79316647	GenBank	EFH65777.1	333	hypothetical protein ARALYDRAFT_311551 [Arabidopsis lyrata subsp. lyrata]
GI:79316647	GenBank	EOA38434.1	259	hypothetical protein CARUB_v10010053mg, partial [Capsella rubella]
GI:79316647	RefSeq	XP_002889518.1	333	hypothetical protein ARALYDRAFT_311551 [Arabidopsis lyrata subsp. lyrata]
GI:79316647	RefSeq	XP_006305536.1	259	hypothetical protein CARUB_v10010053mg, partial [Capsella rubella]
GI:79316647	RefSeq	XP_010457521.1	234	PREDICTED: octanoyltransferase [Camelina sativa]