Gene/Proteome Database (LMPD)

LMPD ID
LMP010675
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
pathogenesis-related protein LTP9
Gene Symbol
Synonyms
F27O10.2; F27O10_2
Alternate Names
pathogenesis-related protein LTP9
Chromosome
2
Summary
Predicted to encode a PR (pathogenesis-related) protein. Belongs to the lipid transfer protein (PR-14) family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
Orthologs

Proteins

pathogenesis-related protein LTP9
Refseq ID NP_179135
Protein GI 42569051
UniProt ID Q6AWW0
mRNA ID NM_127093
Length 121
RefSeq Status REVIEWED
MRKSISIAFVIAITIFMSHLNVFTVYSLTPCEEATNLLTPCLRYLWAPPEAKPSPECCSGLDKVNKGVKTYDDRHDMCICLSSEAAITSADQYKFDNLPKLCNVALFAPVGPKFDCSTIKV

Gene Information

Entrez Gene ID
Gene Name
pathogenesis-related protein LTP9
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
pathogenesis-related protein LTP9
Protein Entry
NLTP9_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Sequence Caution Sequence=AAM15319.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAM15478.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010675 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
42569051 RefSeq NP_179135 121 pathogenesis-related protein LTP9

Identical Sequences to LMP010675 proteins

Reference Database Accession Length Protein Name
GI:42569051 GenBank AAT85734.1 121 At2g15325 [Arabidopsis thaliana]
GI:42569051 GenBank AEC06388.1 121 pathogenesis-related protein LTP10 [Arabidopsis thaliana]
GI:42569051 GenBank AGV98137.1 121 Sequence 252 from patent US 8513488
GI:42569051 SwissProt Q6AWW0.1 121 RecName: Full=Non-specific lipid-transfer protein 9; Short=LTP 9; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010675 proteins

Reference Database Accession Length Protein Name
GI:42569051 GenBank AAM15319.1 118 hypothetical protein [Arabidopsis thaliana]
GI:42569051 GenBank AAM15478.1 118 hypothetical protein [Arabidopsis thaliana]
GI:42569051 GenBank EFH62215.1 119 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:42569051 RefSeq XP_002885956.1 119 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:42569051 RefSeq XP_010518140.1 121 PREDICTED: non-specific lipid-transfer protein 9-like [Camelina sativa]
GI:42569051 RefSeq XP_010467294.1 121 PREDICTED: non-specific lipid-transfer protein 9-like isoform X1 [Camelina sativa]