Gene/Proteome Database (LMPD)

LMPD ID
LMP010674
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
non-specific lipid-transfer protein 8
Gene Symbol
Synonyms
T30D6.12; T30D6_12
Alternate Names
non-specific lipid-transfer protein 8
Chromosome
2
Summary
Predicted to encode a PR (pathogenesis-related) protein. Belongs to the lipid transfer protein (PR-14) family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
Orthologs

Proteins

non-specific lipid-transfer protein 8
Refseq ID NP_179428
Protein GI 15224163
UniProt ID Q9ZPW9
mRNA ID NM_127394
Length 116
RefSeq Status REVIEWED
MNVLKCLAIISVLGIFFIPRYSESAISCSVVLQDLQPCVSYLTSGSGNPPETCCDGVKSLAAATTTSADKKAACQCIKSVANSVTVKPELAQALASNCGASLPVDASPTVDCTTVG

Gene Information

Entrez Gene ID
Gene Name
non-specific lipid-transfer protein 8
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
non-specific lipid-transfer protein 8
Protein Entry
NLTP8_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010674 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15224163 RefSeq NP_179428 116 non-specific lipid-transfer protein 8

Identical Sequences to LMP010674 proteins

Reference Database Accession Length Protein Name
GI:15224163 DBBJ BAF01401.1 116 putative lipid transfer protein [Arabidopsis thaliana]
GI:15224163 GenBank AAM60950.1 116 putative lipid transfer protein [Arabidopsis thaliana]
GI:15224163 GenBank AEC06762.1 116 non-specific lipid-transfer protein 8 [Arabidopsis thaliana]
GI:15224163 gnl TIGR 116 putative lipid transfer protein [Arabidopsis thaliana]
GI:15224163 SwissProt Q9ZPW9.1 116 RecName: Full=Non-specific lipid-transfer protein 8; Short=LTP 8; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010674 proteins

Reference Database Accession Length Protein Name
GI:15224163 GenBank EFH60389.1 116 protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis lyrata subsp. lyrata]
GI:15224163 RefSeq XP_002884130.1 116 protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis lyrata subsp. lyrata]
GI:15224163 RefSeq XP_010414245.1 117 PREDICTED: non-specific lipid-transfer protein 8 [Camelina sativa]
GI:15224163 RefSeq XP_010467649.1 117 PREDICTED: non-specific lipid-transfer protein 8 isoform X1 [Camelina sativa]
GI:15224163 RefSeq XP_010467650.1 117 PREDICTED: non-specific lipid-transfer protein 8 isoform X2 [Camelina sativa]
GI:15224163 RefSeq XP_010489543.1 117 PREDICTED: non-specific lipid-transfer protein 8 [Camelina sativa]