Gene/Proteome Database (LMPD)

LMPD ID
LMP010671
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
non-specific lipid-transfer protein 4
Gene Symbol
Synonyms
lipid transfer protein 4; LTP4; MNC17.4; MNC17_4
Alternate Names
non-specific lipid-transfer protein 4
Chromosome
5

Proteins

non-specific lipid-transfer protein 4
Refseq ID NP_568904
Protein GI 18424223
UniProt ID Q9LLR6
mRNA ID NM_125322
Length 112
RefSeq Status REVIEWED
MAFALRFFTCFVLTVFIVASVDAAITCGTVASSLSPCLGYLSKGGVVPPPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKGVNPSLASGLPGKCGVSIPYPISTSTNCATIK

Gene Information

Entrez Gene ID
Gene Name
non-specific lipid-transfer protein 4
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 TAS:TAIR P lipid transport
GO:0009737 IEP:TAIR P response to abscisic acid
GO:0009651 IEP:TAIR P response to salt stress
GO:0009414 IEP:TAIR P response to water deprivation

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
non-specific lipid-transfer protein 4
Protein Entry
NLTP4_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Sequence Caution Sequence=BAB09776.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010671 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18424223 RefSeq NP_568904 112 non-specific lipid-transfer protein 4

Identical Sequences to LMP010671 proteins

Reference Database Accession Length Protein Name
GI:18424223 GenBank AAL15187.1 112 putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana]
GI:18424223 GenBank AAM65751.1 112 nonspecific lipid-transfer protein precursor-like [Arabidopsis thaliana]
GI:18424223 GenBank AAO00757.1 112 nonspecific lipid-transfer protein precursor - like [Arabidopsis thaliana]
GI:18424223 GenBank AAP21322.1 112 At5g59310 [Arabidopsis thaliana]
GI:18424223 gnl TAIR 112 non-specific lipid-transfer protein 4 [Arabidopsis thaliana]
GI:18424223 SwissProt Q9LLR6.1 112 RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP 4; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010671 proteins

Reference Database Accession Length Protein Name
GI:18424223 DBBJ BAB09776.1 110 lipid transfer protein-like [Arabidopsis thaliana]
GI:18424223 GenBank EFH42585.1 112 hypothetical protein ARALYDRAFT_919161 [Arabidopsis lyrata subsp. lyrata]
GI:18424223 RefSeq XP_002866326.1 112 hypothetical protein ARALYDRAFT_919161 [Arabidopsis lyrata subsp. lyrata]
GI:18424223 RefSeq XP_010454858.1 112 PREDICTED: non-specific lipid-transfer protein 4-like [Camelina sativa]
GI:18424223 RefSeq XP_010454869.1 112 PREDICTED: non-specific lipid-transfer protein 4-like [Camelina sativa]
GI:18424223 RefSeq XP_010483549.1 112 PREDICTED: non-specific lipid-transfer protein 4 [Camelina sativa]