Gene/Proteome Database (LMPD)
LMPD ID
LMP010623
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sterol 4-alpha-methyl-oxidase
Gene Symbol
Synonyms
ATSMO2; F22G5.23; F22G5_23; SMO2-1; STEROL 4-ALPHA-METHYL-OXIDASE 2; sterol 4-alpha-methyl-oxidase 2-1
Alternate Names
sterol 4-alpha-methyl-oxidase
Chromosome
1
EC Number
1.14.13.72
Summary
Arabidopsis thaliana sterol 4-alpha-methyl-oxidase mRNA
Orthologs
Proteins
| sterol 4-alpha-methyl-oxidase | |
|---|---|
| Refseq ID | NP_563789 |
| Protein GI | 18390767 |
| UniProt ID | Q8VWZ8 |
| mRNA ID | NM_100616 |
| Length | 266 |
| RefSeq Status | REVIEWED |
| MASFVESGWQYLVTHFSDFQLACIGSFLLHESVFFLSGLPFIFLERQGFLSKYKIQTKNNTPAAQGKCITRLLLYHFSVNLPLMLASYPVFRAMGMRSSFPLPSWKEVSAQILFYFIIEDFVFYWGHRILHSKWLYKNVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPALTGPHLITLWLWMVLRVLETVEAHCGYHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNYSSTFVYMDWIFGTDKGYRRLKTLKENGDMKQT | |
| sterol 4-alpha-methyl-oxidase | |
|---|---|
| Refseq ID | NP_973777 |
| Protein GI | 42571373 |
| UniProt ID | Q8VWZ8 |
| mRNA ID | NM_202048 |
| Length | 228 |
| RefSeq Status | REVIEWED |
| MLLLPFMVNTYFSFVPMQTKNNTPAAQGKCITRLLLYHFSVNLPLMLASYPVFRAMGMRSSFPLPSWKEVSAQILFYFIIEDFVFYWGHRILHSKWLYKNVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPALTGPHLITLWLWMVLRVLETVEAHCGYHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNYSSTFVYMDWIFGTDKGYRRLKTLKENGDMKQT | |
Gene Information
Entrez Gene ID
Gene Name
sterol 4-alpha-methyl-oxidase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0000254 | IEA:UniProtKB-EC | F | C-4 methylsterol oxidase activity |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
sterol 4-alpha-methyl-oxidase
Protein Entry
SMO22_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8VWZ8-1; Sequence=Displayed; Name=2; IsoId=Q8VWZ8-2; Sequence=VSP_041865; |
| Catalytic Activity | 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-arbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O. |
| Catalytic Activity | 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + CA NAD(P)(+) + H(2)O. |
| Catalytic Activity | 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O. |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Function | Non-heme iron oxygenase involved in sterols biosynthesis. 24-ethylidenelophenol and 24-ethyllophenol are the preferred substrates. {ECO:0000269|PubMed:11707264}. |
| Miscellaneous | Requires a membrane-bound cytochrome b5 as an obligatory electron carrier from NAD(P)H to SMO. |
| Sequence Caution | Sequence=AAF79571.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010623 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18390767 | RefSeq | NP_563789 | 266 | sterol 4-alpha-methyl-oxidase |
| 42571373 | RefSeq | NP_973777 | 228 | sterol 4-alpha-methyl-oxidase |
Identical Sequences to LMP010623 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42571373 | DBBJ | BAH19532.1 | 228 | AT1G07420 [Arabidopsis thaliana] |
| GI:18390767 | EMBL | CAR81286.1 | 266 | unnamed protein product [Arabidopsis thaliana] |
| GI:18390767 | EMBL | CBX84764.1 | 266 | unnamed protein product [Arabidopsis thaliana] |
| GI:18390767 | GenBank | ACI31310.1 | 266 | At1g07420 [Arabidopsis thaliana] |
| GI:18390767 | GenBank | ACX17324.1 | 266 | Sequence 44761 from patent US 7569389 |
| GI:18390767 | GenBank | AEE28122.1 | 266 | methylsterol monooxygenase [Arabidopsis thaliana] |
| GI:42571373 | GenBank | AEE28123.1 | 228 | methylsterol monooxygenase [Arabidopsis thaliana] |
| GI:18390767 | SwissProt | Q8VWZ8.1 | 266 | RecName: Full=Methylsterol monooxygenase 2-2; AltName: Full=Sterol 4-alpha-methyl-oxidase 1; Short=AtSMO1; AltName: Full=Sterol 4-alpha-methyl-oxidase 2-2 [Arabidopsis thaliana] |
Related Sequences to LMP010623 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42571373 | EMBL | CAR81286.1 | 266 | unnamed protein product [Arabidopsis thaliana] |
| GI:18390767 | EMBL | CAR81345.1 | 266 | unnamed protein product [Arabidopsis thaliana] |
| GI:42571373 | EMBL | CAR81347.1 | 261 | unnamed protein product [Arabidopsis thaliana] |
| GI:18390767 | EMBL | CBX84821.1 | 266 | unnamed protein product [Arabidopsis thaliana] |
| GI:42571373 | EMBL | CBX84823.1 | 261 | unnamed protein product [Arabidopsis thaliana] |
| GI:42571373 | GenBank | AAF79571.1 | 261 | F22G5.23 [Arabidopsis thaliana] |
| GI:18390767 | GenBank | AAM64821.1 | 266 | putative C-4 sterol methyl oxidase [Arabidopsis thaliana] |
| GI:42571373 | GenBank | ACX17324.1 | 266 | Sequence 44761 from patent US 7569389 |
| GI:18390767 | GenBank | EFH65906.1 | 266 | sterol 4-alpha-methyl-oxidase 2 [Arabidopsis lyrata subsp. lyrata] |
| GI:18390767 | GenBank | ESQ36159.1 | 266 | hypothetical protein EUTSA_v10008485mg [Eutrema salsugineum] |
| GI:18390767 | RefSeq | XP_002889647.1 | 266 | sterol 4-alpha-methyl-oxidase 2 [Arabidopsis lyrata subsp. lyrata] |
| GI:42571373 | SwissProt | Q8VWZ8.1 | 266 | RecName: Full=Methylsterol monooxygenase 2-2; AltName: Full=Sterol 4-alpha-methyl-oxidase 1; Short=AtSMO1; AltName: Full=Sterol 4-alpha-methyl-oxidase 2-2 [Arabidopsis thaliana] |