Gene/Proteome Database (LMPD)
LMPD ID
LMP010619
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sterol-4alpha-methyl oxidase 1-1
Gene Symbol
Synonyms
ATSMO1; ATSMO1-1; F16J13.180; F16J13_180; SMO1-1; STEROL 4-ALPHA-METHYL-OXIDASE 1; sterol-4alpha-methyl oxidase 1-1
Alternate Names
sterol-4alpha-methyl oxidase 1-1
Chromosome
4
EC Number
1.14.13.72
Summary
Encodes a member of the SMO1 family of sterol 4alpha-methyl oxidases. More specifically functions as a 4,4-dimethyl-9beta,19-cyclopropylsterol-4alpha- methyl oxidase.
Orthologs
Proteins
| sterol-4alpha-methyl oxidase 1-1 | |
|---|---|
| Refseq ID | NP_192948 |
| Protein GI | 15234416 |
| UniProt ID | Q8L7W5 |
| mRNA ID | NM_117281 |
| Length | 298 |
| RefSeq Status | REVIEWED |
| MIPYATVEEASIALGRNLTRLETLWFDYSATKSDYYLYCHNILFLFLVFSLVPLPLVFVELARSASGLFNRYKIQPKVNYSLSDMFKCYKDVMTMFILVVGPLQLVSYPSIQMIEIRSGLPLPTITEMLSQLVVYFLIEDYTNYWVHRFFHSKWGYDKIHRVHHEYTAPIGYAAPYAHWAEVLLLGIPTFMGPAIAPGHMITFWLWIALRQMEAIETHSGYDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNGGIKSD | |
Gene Information
Entrez Gene ID
Gene Name
sterol-4alpha-methyl oxidase 1-1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | TAS:TAIR | C | membrane |
| GO:0000254 | IMP:TAIR | F | C-4 methylsterol oxidase activity |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0016126 | IMP:TAIR | P | sterol biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
sterol-4alpha-methyl oxidase 1-1
Protein Entry
SMO11_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O. {ECO:0000269|PubMed:14653780}. |
| Catalytic Activity | 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)(+) + H(2)O. {ECO:0000269|PubMed:14653780}. |
| Catalytic Activity | 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O. {ECO:0000269|PubMed:14653780}. |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Function | Non-heme iron oxygenase involved in sterols biosynthesis. 4,4-dimethyl-9-beta,19-cyclopropylsterols such as 24-methylenecycloartanol are the preferred substrates. {ECO:0000269|PubMed:14653780}. |
| Miscellaneous | Requires a membrane-bound cytochrome b5 as an obligatory electron carrier from NAD(P)H to SMO. {ECO:0000250}. |
| Sequence Caution | Sequence=CAB40952.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB78254.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010619 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15234416 | RefSeq | NP_192948 | 298 | sterol-4alpha-methyl oxidase 1-1 |
Identical Sequences to LMP010619 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15234416 | EMBL | CAR81284.1 | 298 | unnamed protein product [Arabidopsis thaliana] |
| GI:15234416 | EMBL | CBX84762.1 | 298 | unnamed protein product [Arabidopsis thaliana] |
| GI:15234416 | GenBank | ACX17437.1 | 298 | Sequence 44916 from patent US 7569389 |
| GI:15234416 | GenBank | ACX19383.1 | 298 | Sequence 47541 from patent US 7569389 |
| GI:15234416 | GenBank | AEE83097.1 | 298 | sterol-4alpha-methyl oxidase 1-1 [Arabidopsis thaliana] |
| GI:15234416 | GenBank | AEU45697.1 | 298 | Sequence 7 from patent US 8053639 |
Related Sequences to LMP010619 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15234416 | EMBL | CAR81335.1 | 298 | unnamed protein product [Arabidopsis thaliana] |
| GI:15234416 | EMBL | CAR81344.1 | 298 | unnamed protein product [Arabidopsis thaliana] |
| GI:15234416 | EMBL | CBX84813.1 | 298 | unnamed protein product [Arabidopsis thaliana] |
| GI:15234416 | EMBL | CBX84820.1 | 298 | unnamed protein product [Arabidopsis thaliana] |
| GI:15234416 | GenBank | AAM64961.1 | 298 | putative C-4 sterol methyl oxidase [Arabidopsis thaliana] |
| GI:15234416 | GenBank | AAQ13424.1 | 298 | sterol-4-methyl-oxidase [Arabidopsis thaliana] |