Gene/Proteome Database (LMPD)
Proteins
| lysophosphatidylcholine acyltransferase | |
|---|---|
| Refseq ID | NP_176493 |
| Protein GI | 15221667 |
| UniProt ID | Q9CAN8 |
| mRNA ID | NM_104983 |
| Length | 465 |
| RefSeq Status | REVIEWED |
| MELLDMNSMAASIGVSVAVLRFLLCFVATIPISFLWRFIPSRLGKHIYSAASGAFLSYLSFGFSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVFEMKDYLEWTEEKGIWAVSEKGKRPSPYGAMIRAVFQAAICMALYLYLVPQFPLTRFTEPVYQEWGFLKRFGYQYMAGFTARWKYYFIWSISEASIIISGLGFSGWTDETQTKAKWDRAKNVDILGVELAKSAVQIPLFWNIQVSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIYRWQQAIPPKMAMLRNVLVLINFLYTVVVLNYSSVGFMVLSLHETLVAFKSVYYIGTVIPIAVLLLSYLVPVKPVRPKTRKEE | |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidylcholine acyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0047184 | IMP:TAIR | F | 1-acylglycerophosphocholine O-acyltransferase activity |
| GO:0071617 | IGI:TAIR | F | lysophospholipid acyltransferase activity |
| GO:0016746 | IDA:TAIR | F | transferase activity, transferring acyl groups |
| GO:0045017 | IMP:TAIR | P | glycerolipid biosynthetic process |
| GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
| GO:0019432 | IGI:TAIR | P | triglyceride biosynthetic process |
| GO:0006641 | IMP:TAIR | P | triglyceride metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath00565 | Ether lipid metabolism |
| ath00561 | Glycerolipid metabolism |
| ath00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6254310 | Acyl chain remodelling of PI |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004299 | Membrane bound O-acyl transferase, MBOAT |
UniProt Annotations
Entry Information
Gene Name
lysophosphatidylcholine acyltransferase
Protein Entry
MBOA2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3- phosphatidylserine = CoA + 1,2-diacyl-sn-glycero-3- phosphatidylserine. |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3- phosphoethanolamine = CoA + 1,2-diacyl-sn-glycero-3- phosphoethanolamine. |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl-sn-glycero-3-phosphocholine. |
| Disruption Phenotype | No visible phenotype under normal growth conditions, but the double mutants lpcat1 and lpcat2-2 show increased contents of very-long-chain fatty acids and decreased polyunsaturated fatty acids in seed triacylglycerols. {ECO:0000269|PubMed:22233193, ECO:0000269|PubMed:22932756, ECO:0000269|PubMed:23150634}. |
| Function | Lysophospholipid acyltransferase with broad specificity. Mediates the conversion of lysophosphatidylethanolamine (1-acyl- sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3- phosphoethanolamine or PE) (LPEAT activity). Catalyzes the acylation of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero- 3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn- glycero-3-phospho-L-serine or PS) (LPSAT activity). Can convert lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3- phosphocholine or PC) (LPCAT activity) Can also utilizes lysophosphatidylglycerol (LPG) as substrate in vitro. Has neither activity towards lysophosphatidic acid (LPA) nor lysophosphatidylinositol (LPI). Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. The primary function of the Lands cycle is to provide a route for acyl remodeling to modify fatty acid (FA) composition of phospholipids derived from the Kennedy pathway. Is involved in PC acyl editing and phosphocholine headgroup exchange between PC and diacylglycerols. This processes control the majority of acyl fluxes through PC to provide polyunsaturated fatty acids for triacylglycerols synthesis in seeds. {ECO:0000269|PubMed:18154737, ECO:0000269|PubMed:22932756, ECO:0000269|PubMed:23150634}. |
| Similarity | Belongs to the membrane-bound acyltransferase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305|PubMed:22923678}; Multi-pass membrane protein {ECO:0000305|PubMed:22923678}. |
| Tissue Specificity | Expressed in rosette leaves, pollen grains, developing embryos and developing seeds. {ECO:0000269|PubMed:23150634}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010588 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15221667 | RefSeq | NP_176493 | 465 | lysophosphatidylcholine acyltransferase |
Identical Sequences to LMP010588 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221667 | GenBank | AEE34045.1 | 465 | lysophosphatidylcholine acyltransferase [Arabidopsis thaliana] |
| GI:15221667 | GenBank | AFL40377.1 | 465 | Sequence 112 from patent US 8193414 |
| GI:15221667 | GenBank | AGM70819.1 | 465 | Sequence 6 from patent US 8383886 |
| GI:15221667 | GenBank | AGM70837.1 | 465 | Sequence 37 from patent US 8383886 |
| GI:15221667 | GenBank | AGM70855.1 | 465 | Sequence 55 from patent US 8383886 |
| GI:15221667 | GenBank | AGM70875.1 | 465 | Sequence 75 from patent US 8383886 |
Related Sequences to LMP010588 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221667 | GenBank | EFH62697.1 | 465 | membrane bound O-acyl transferase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221667 | GenBank | EOA33343.1 | 531 | hypothetical protein CARUB_v10020125mg [Capsella rubella] |
| GI:15221667 | RefSeq | XP_002886438.1 | 465 | membrane bound O-acyl transferase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221667 | RefSeq | XP_006300445.1 | 531 | hypothetical protein CARUB_v10020125mg [Capsella rubella] |
| GI:15221667 | RefSeq | XP_010430382.1 | 465 | PREDICTED: lysophospholipid acyltransferase 2-like [Camelina sativa] |
| GI:15221667 | RefSeq | XP_010473534.1 | 465 | PREDICTED: lysophospholipid acyltransferase 2 [Camelina sativa] |