Gene/Proteome Database (LMPD)

LMPD ID
LMP010582
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
lycopene beta cyclase
Gene Symbol
LYC
Synonyms
LYCOPENE BETA-CYCLASE; lycopene cyclase
Alternate Names
lycopene beta cyclase
Chromosome
3
EC Number
5.5.1.19
Summary
Encodes a protein with lycopene β-cyclase activity. This enzyme uses the linear, symmetrical lycopene as substrate. However, unlike the ε-cyclase which adds only one ring, the β-cyclase introduces a ring at both ends of lycopene to form the bicyclic β-carotene.
Orthologs

Proteins

lycopene beta cyclase
Refseq ID NP_001078131
Protein GI 145332018
UniProt ID Q38933
mRNA ID NM_001084662
Length 369
RefSeq Status REVIEWED
MDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLEIMTKGTVPLAKMINNLVQDRD
lycopene beta cyclase
Refseq ID NP_187634
Protein GI 15228239
UniProt ID Q38933
mRNA ID NM_111858
Length 501
RefSeq Status REVIEWED
MDTLLKTPNKLDFFIPQFHGFERLCSNNPYHSRVRLGVKKRAIKIVSSVVSGSAALLDLVPETKKENLDFELPLYDTSKSQVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLEIMTKGTVPLAKMINNLVQDRD

Gene Information

Entrez Gene ID
Gene Name
lycopene beta cyclase
Gene Symbol
LYC
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IEA:UniProtKB-KW C chloroplast
GO:0016853 IEA:UniProtKB-KW F isomerase activity
GO:0016705 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016117 IEA:UniProtKB-KW P carotenoid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath00906 Carotenoid biosynthesis
ath01100 Metabolic pathways
ath_M00097 beta-Carotene biosynthesis, GGAP => beta-carotene

Domain Information

InterPro Annotations

Accession Description
IPR010108 Lycopene cyclase, beta/epsilon
IPR008671 Lycopene cyclase-type, FAD-binding

UniProt Annotations

Entry Information

Gene Name
lycopene beta cyclase
Protein Entry
LCYB_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q38933-1; Sequence=Displayed; Name=2; IsoId=Q38933-2; Sequence=VSP_035546; Note=Derived from EST data. No experimental confirmation available.;
Catalytic Activity Carotenoid psi-end group = carotenoid beta-end group.
Function Catalyzes the double cyclization reaction which converts lycopene to beta-carotene and neurosporene to beta-zeacarotene.
Pathway Carotenoid biosynthesis; beta-carotene biosynthesis.
Pathway Carotenoid biosynthesis; beta-zeacarotene biosynthesis.
Similarity Belongs to the lycopene cyclase family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast.

Identical and Related Proteins

Unique RefSeq proteins for LMP010582 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15228239 RefSeq NP_187634 501 lycopene beta cyclase
145332018 RefSeq NP_001078131 369 lycopene beta cyclase

Identical Sequences to LMP010582 proteins

Reference Database Accession Length Protein Name
GI:15228239 GenBank AAF82388.1 501 lycopene beta cyclase [Arabidopsis thaliana]
GI:15228239 GenBank AAL24097.1 501 putative lycopene beta cyclase [Arabidopsis thaliana]
GI:15228239 GenBank AAM14335.1 501 putative lycopene beta cyclase [Arabidopsis thaliana]
GI:15228239 GenBank AAR75836.1 501 Sequence 55 from patent US 6642021
GI:15228239 GenBank AEE74874.1 501 lycopene beta cyclase [Arabidopsis thaliana]
GI:145332018 GenBank AEE74875.1 369 lycopene beta cyclase [Arabidopsis thaliana]
GI:15228239 SwissProt Q38933.1 501 RecName: Full=Lycopene beta cyclase, chloroplastic; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010582 proteins

Reference Database Accession Length Protein Name
GI:15228239 EMBL CAG26505.1 500 unnamed protein product, partial [Arabidopsis thaliana]
GI:15228239 GenBank AAA81880.1 501 lycopene cyclase [Arabidopsis thaliana]
GI:145332018 GenBank AAL24097.1 501 putative lycopene beta cyclase [Arabidopsis thaliana]
GI:145332018 GenBank AAM14335.1 501 putative lycopene beta cyclase [Arabidopsis thaliana]
GI:145332018 GenBank AAR75836.1 501 Sequence 55 from patent US 6642021
GI:15228239 GenBank EFH61043.1 501 lycopene cyclase [Arabidopsis lyrata subsp. lyrata]
GI:145332018 GenBank AEE74874.1 501 lycopene beta cyclase [Arabidopsis thaliana]
GI:15228239 GenBank ESQ49045.1 500 hypothetical protein EUTSA_v10020573mg [Eutrema salsugineum]
GI:145332018 RefSeq NP_187634.1 501 lycopene beta cyclase [Arabidopsis thaliana]
GI:15228239 RefSeq XP_002884784.1 501 lycopene cyclase [Arabidopsis lyrata subsp. lyrata]
GI:15228239 RefSeq XP_006407592.1 500 hypothetical protein EUTSA_v10020573mg [Eutrema salsugineum]
GI:145332018 SwissProt Q38933.1 501 RecName: Full=Lycopene beta cyclase, chloroplastic; Flags: Precursor [Arabidopsis thaliana]