Gene/Proteome Database (LMPD)
LMPD ID
LMP010582
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
lycopene beta cyclase
Gene Symbol
Synonyms
LYCOPENE BETA-CYCLASE; lycopene cyclase
Alternate Names
lycopene beta cyclase
Chromosome
3
EC Number
5.5.1.19
Summary
Encodes a protein with lycopene β-cyclase activity. This enzyme uses the linear, symmetrical lycopene as substrate. However, unlike the ε-cyclase which adds only one ring, the β-cyclase introduces a ring at both ends of lycopene to form the bicyclic β-carotene.
Orthologs
Proteins
| lycopene beta cyclase | |
|---|---|
| Refseq ID | NP_001078131 |
| Protein GI | 145332018 |
| UniProt ID | Q38933 |
| mRNA ID | NM_001084662 |
| Length | 369 |
| RefSeq Status | REVIEWED |
| MDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLEIMTKGTVPLAKMINNLVQDRD | |
| lycopene beta cyclase | |
|---|---|
| Refseq ID | NP_187634 |
| Protein GI | 15228239 |
| UniProt ID | Q38933 |
| mRNA ID | NM_111858 |
| Length | 501 |
| RefSeq Status | REVIEWED |
| MDTLLKTPNKLDFFIPQFHGFERLCSNNPYHSRVRLGVKKRAIKIVSSVVSGSAALLDLVPETKKENLDFELPLYDTSKSQVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLEIMTKGTVPLAKMINNLVQDRD | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IEA:UniProtKB-KW | C | chloroplast |
| GO:0016853 | IEA:UniProtKB-KW | F | isomerase activity |
| GO:0016705 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
| GO:0016117 | IEA:UniProtKB-KW | P | carotenoid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01110 | Biosynthesis of secondary metabolites |
| ath00906 | Carotenoid biosynthesis |
| ath01100 | Metabolic pathways |
| ath_M00097 | beta-Carotene biosynthesis, GGAP => beta-carotene |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q38933-1; Sequence=Displayed; Name=2; IsoId=Q38933-2; Sequence=VSP_035546; Note=Derived from EST data. No experimental confirmation available.; |
| Catalytic Activity | Carotenoid psi-end group = carotenoid beta-end group. |
| Function | Catalyzes the double cyclization reaction which converts lycopene to beta-carotene and neurosporene to beta-zeacarotene. |
| Pathway | Carotenoid biosynthesis; beta-carotene biosynthesis. |
| Pathway | Carotenoid biosynthesis; beta-zeacarotene biosynthesis. |
| Similarity | Belongs to the lycopene cyclase family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010582 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15228239 | RefSeq | NP_187634 | 501 | lycopene beta cyclase |
| 145332018 | RefSeq | NP_001078131 | 369 | lycopene beta cyclase |
Identical Sequences to LMP010582 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15228239 | GenBank | AAF82388.1 | 501 | lycopene beta cyclase [Arabidopsis thaliana] |
| GI:15228239 | GenBank | AAL24097.1 | 501 | putative lycopene beta cyclase [Arabidopsis thaliana] |
| GI:15228239 | GenBank | AAM14335.1 | 501 | putative lycopene beta cyclase [Arabidopsis thaliana] |
| GI:15228239 | GenBank | AAR75836.1 | 501 | Sequence 55 from patent US 6642021 |
| GI:15228239 | GenBank | AEE74874.1 | 501 | lycopene beta cyclase [Arabidopsis thaliana] |
| GI:145332018 | GenBank | AEE74875.1 | 369 | lycopene beta cyclase [Arabidopsis thaliana] |
| GI:15228239 | SwissProt | Q38933.1 | 501 | RecName: Full=Lycopene beta cyclase, chloroplastic; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010582 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15228239 | EMBL | CAG26505.1 | 500 | unnamed protein product, partial [Arabidopsis thaliana] |
| GI:15228239 | GenBank | AAA81880.1 | 501 | lycopene cyclase [Arabidopsis thaliana] |
| GI:145332018 | GenBank | AAL24097.1 | 501 | putative lycopene beta cyclase [Arabidopsis thaliana] |
| GI:145332018 | GenBank | AAM14335.1 | 501 | putative lycopene beta cyclase [Arabidopsis thaliana] |
| GI:145332018 | GenBank | AAR75836.1 | 501 | Sequence 55 from patent US 6642021 |
| GI:15228239 | GenBank | EFH61043.1 | 501 | lycopene cyclase [Arabidopsis lyrata subsp. lyrata] |
| GI:145332018 | GenBank | AEE74874.1 | 501 | lycopene beta cyclase [Arabidopsis thaliana] |
| GI:15228239 | GenBank | ESQ49045.1 | 500 | hypothetical protein EUTSA_v10020573mg [Eutrema salsugineum] |
| GI:145332018 | RefSeq | NP_187634.1 | 501 | lycopene beta cyclase [Arabidopsis thaliana] |
| GI:15228239 | RefSeq | XP_002884784.1 | 501 | lycopene cyclase [Arabidopsis lyrata subsp. lyrata] |
| GI:15228239 | RefSeq | XP_006407592.1 | 500 | hypothetical protein EUTSA_v10020573mg [Eutrema salsugineum] |
| GI:145332018 | SwissProt | Q38933.1 | 501 | RecName: Full=Lycopene beta cyclase, chloroplastic; Flags: Precursor [Arabidopsis thaliana] |